Spaces:
Sleeping
Sleeping
""" | |
File: CodonPrediction.py | |
--------------------------- | |
Includes functions to tokenize input, load models, infer predicted dna sequences and | |
helper functions related to processing data for passing to the model. | |
""" | |
import warnings | |
from typing import Any, Dict, List, Optional, Tuple, Union | |
import heapq | |
from dataclasses import dataclass | |
import numpy as np | |
import onnxruntime as rt | |
import torch | |
import transformers | |
from transformers import ( | |
AutoTokenizer, | |
BatchEncoding, | |
BigBirdConfig, | |
BigBirdForMaskedLM, | |
PreTrainedTokenizerFast, | |
) | |
from CodonTransformer.CodonData import get_merged_seq | |
from CodonTransformer.CodonUtils import ( | |
AMINO_ACID_TO_INDEX, | |
INDEX2TOKEN, | |
NUM_ORGANISMS, | |
ORGANISM2ID, | |
TOKEN2INDEX, | |
DNASequencePrediction, | |
GC_COUNTS_PER_TOKEN, | |
CODON_GC_CONTENT, | |
AA_MIN_GC, | |
AA_MAX_GC, | |
) | |
def predict_dna_sequence( | |
protein: str, | |
organism: Union[int, str], | |
device: torch.device, | |
tokenizer: Union[str, PreTrainedTokenizerFast] = None, | |
model: Union[str, torch.nn.Module] = None, | |
attention_type: str = "original_full", | |
deterministic: bool = True, | |
temperature: float = 0.2, | |
top_p: float = 0.95, | |
num_sequences: int = 1, | |
match_protein: bool = False, | |
use_constrained_search: bool = False, | |
gc_bounds: Tuple[float, float] = (0.30, 0.70), | |
beam_size: int = 5, | |
length_penalty: float = 1.0, | |
diversity_penalty: float = 0.0, | |
) -> Union[DNASequencePrediction, List[DNASequencePrediction]]: | |
""" | |
Predict the DNA sequence(s) for a given protein using the CodonTransformer model. | |
This function takes a protein sequence and an organism (as ID or name) as input | |
and returns the predicted DNA sequence(s) using the CodonTransformer model. It can use | |
either provided tokenizer and model objects or load them from specified paths. | |
Args: | |
protein (str): The input protein sequence for which to predict the DNA sequence. | |
organism (Union[int, str]): Either the ID of the organism or its name (e.g., | |
"Escherichia coli general"). If a string is provided, it will be converted | |
to the corresponding ID using ORGANISM2ID. | |
device (torch.device): The device (CPU or GPU) to run the model on. | |
tokenizer (Union[str, PreTrainedTokenizerFast, None], optional): Either a file | |
path to load the tokenizer from, a pre-loaded tokenizer object, or None. If | |
None, it will be loaded from HuggingFace. Defaults to None. | |
model (Union[str, torch.nn.Module, None], optional): Either a file path to load | |
the model from, a pre-loaded model object, or None. If None, it will be | |
loaded from HuggingFace. Defaults to None. | |
attention_type (str, optional): The type of attention mechanism to use in the | |
model. Can be either 'block_sparse' or 'original_full'. Defaults to | |
"original_full". | |
deterministic (bool, optional): Whether to use deterministic decoding (most | |
likely tokens). If False, samples tokens according to their probabilities | |
adjusted by the temperature. Defaults to True. | |
temperature (float, optional): A value controlling the randomness of predictions | |
during non-deterministic decoding. Lower values (e.g., 0.2) make the model | |
more conservative, while higher values (e.g., 0.8) increase randomness. | |
Using high temperatures may result in prediction of DNA sequences that | |
do not translate to the input protein. | |
Recommended values are: | |
- Low randomness: 0.2 | |
- Medium randomness: 0.5 | |
- High randomness: 0.8 | |
The temperature must be a positive float. Defaults to 0.2. | |
top_p (float, optional): The cumulative probability threshold for nucleus sampling. | |
Tokens with cumulative probability up to top_p are considered for sampling. | |
This parameter helps balance diversity and coherence in the predicted DNA sequences. | |
The value must be a float between 0 and 1. Defaults to 0.95. | |
num_sequences (int, optional): The number of DNA sequences to generate. Only applicable | |
when deterministic is False. Defaults to 1. | |
match_protein (bool, optional): Ensures the predicted DNA sequence is translated | |
to the input protein sequence by sampling from only the respective codons of | |
given amino acids. Defaults to False. | |
use_constrained_search (bool, optional): Whether to use constrained beam search | |
with GC content bounds. Defaults to False. | |
gc_bounds (Tuple[float, float], optional): GC content bounds (min, max) for | |
constrained search. Defaults to (0.30, 0.70). | |
beam_size (int, optional): Beam size for constrained search. Defaults to 5. | |
length_penalty (float, optional): Length penalty for beam search scoring. | |
Defaults to 1.0. | |
diversity_penalty (float, optional): Diversity penalty to reduce repetitive | |
sequences. Defaults to 0.0. | |
Returns: | |
Union[DNASequencePrediction, List[DNASequencePrediction]]: An object or list of objects | |
containing the prediction results: | |
- organism (str): Name of the organism used for prediction. | |
- protein (str): Input protein sequence for which DNA sequence is predicted. | |
- processed_input (str): Processed input sequence (merged protein and DNA). | |
- predicted_dna (str): Predicted DNA sequence. | |
Raises: | |
ValueError: If the protein sequence is empty, if the organism is invalid, | |
if the temperature is not a positive float, if top_p is not between 0 and 1, | |
or if num_sequences is less than 1 or used with deterministic mode. | |
Note: | |
This function uses ORGANISM2ID, INDEX2TOKEN, and AMINO_ACID_TO_INDEX dictionaries | |
imported from CodonTransformer.CodonUtils. ORGANISM2ID maps organism names to their | |
corresponding IDs. INDEX2TOKEN maps model output indices (token IDs) to | |
respective codons. AMINO_ACID_TO_INDEX maps each amino acid and stop symbol to indices | |
of codon tokens that translate to it. | |
Example: | |
>>> import torch | |
>>> from transformers import AutoTokenizer, BigBirdForMaskedLM | |
>>> from CodonTransformer.CodonPrediction import predict_dna_sequence | |
>>> from CodonTransformer.CodonJupyter import format_model_output | |
>>> | |
>>> # Set up device | |
>>> device = torch.device("cuda" if torch.cuda.is_available() else "cpu") | |
>>> | |
>>> # Load tokenizer and model | |
>>> tokenizer = AutoTokenizer.from_pretrained("adibvafa/CodonTransformer") | |
>>> model = BigBirdForMaskedLM.from_pretrained("adibvafa/CodonTransformer") | |
>>> model = model.to(device) | |
>>> | |
>>> # Define protein sequence and organism | |
>>> protein = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLA" | |
>>> organism = "Escherichia coli general" | |
>>> | |
>>> # Predict DNA sequence with deterministic decoding (single sequence) | |
>>> output = predict_dna_sequence( | |
... protein=protein, | |
... organism=organism, | |
... device=device, | |
... tokenizer=tokenizer, | |
... model=model, | |
... attention_type="original_full", | |
... deterministic=True | |
... ) | |
>>> | |
>>> # Predict DNA sequence with constrained beam search | |
>>> output_constrained = predict_dna_sequence( | |
... protein=protein, | |
... organism=organism, | |
... device=device, | |
... tokenizer=tokenizer, | |
... model=model, | |
... use_constrained_search=True, | |
... gc_bounds=(0.40, 0.60), | |
... beam_size=10, | |
... length_penalty=1.2, | |
... diversity_penalty=0.1 | |
... ) | |
>>> | |
>>> # Predict multiple DNA sequences with low randomness and top_p sampling | |
>>> output_random = predict_dna_sequence( | |
... protein=protein, | |
... organism=organism, | |
... device=device, | |
... tokenizer=tokenizer, | |
... model=model, | |
... attention_type="original_full", | |
... deterministic=False, | |
... temperature=0.2, | |
... top_p=0.95, | |
... num_sequences=3 | |
... ) | |
>>> | |
>>> print(format_model_output(output)) | |
>>> for i, seq in enumerate(output_random, 1): | |
... print(f"Sequence {i}:") | |
... print(format_model_output(seq)) | |
... print() | |
""" | |
if not protein: | |
raise ValueError("Protein sequence cannot be empty.") | |
if not isinstance(temperature, (float, int)) or temperature <= 0: | |
raise ValueError("Temperature must be a positive float.") | |
if not isinstance(top_p, (float, int)) or not 0 < top_p <= 1.0: | |
raise ValueError("top_p must be a float between 0 and 1.") | |
if not isinstance(num_sequences, int) or num_sequences < 1: | |
raise ValueError("num_sequences must be a positive integer.") | |
if use_constrained_search: | |
if not isinstance(gc_bounds, tuple) or len(gc_bounds) != 2: | |
raise ValueError("gc_bounds must be a tuple of (min_gc, max_gc).") | |
if not (0.0 <= gc_bounds[0] <= gc_bounds[1] <= 1.0): | |
raise ValueError("gc_bounds must be between 0.0 and 1.0 with min <= max.") | |
if not isinstance(beam_size, int) or beam_size < 1: | |
raise ValueError("beam_size must be a positive integer.") | |
if deterministic and num_sequences > 1 and not use_constrained_search: | |
raise ValueError( | |
"Multiple sequences can only be generated in non-deterministic mode " | |
"(unless using constrained search)." | |
) | |
if use_constrained_search and num_sequences > 1: | |
raise ValueError( | |
"Constrained beam search currently supports only single sequence generation." | |
) | |
# Load tokenizer | |
if not isinstance(tokenizer, PreTrainedTokenizerFast): | |
tokenizer = load_tokenizer(tokenizer) | |
# Load model | |
if not isinstance(model, torch.nn.Module): | |
model = load_model(model_path=model, device=device, attention_type=attention_type) | |
else: | |
model.eval() | |
model.bert.set_attention_type(attention_type) | |
model.to(device) | |
# Validate organism and convert to organism_id and organism_name | |
organism_id, organism_name = validate_and_convert_organism(organism) | |
# Inference loop | |
with torch.no_grad(): | |
# Tokenize the input sequence | |
merged_seq = get_merged_seq(protein=protein, dna="") | |
input_dict = { | |
"idx": 0, # sample index | |
"codons": merged_seq, | |
"organism": organism_id, | |
} | |
tokenized_input = tokenize([input_dict], tokenizer=tokenizer).to(device) | |
# Get the model predictions | |
output_dict = model(**tokenized_input, return_dict=True) | |
logits = output_dict.logits.detach().cpu() | |
logits = logits[:, 1:-1, :] # Remove [CLS] and [SEP] tokens | |
# Mask the logits of codons that do not correspond to the input protein sequence | |
if match_protein: | |
possible_tokens_per_position = [ | |
AMINO_ACID_TO_INDEX[token[0]] for token in merged_seq.split(" ") | |
] | |
seq_len = logits.shape[1] | |
if len(possible_tokens_per_position) > seq_len: | |
possible_tokens_per_position = possible_tokens_per_position[:seq_len] | |
mask = torch.full_like(logits, float("-inf")) | |
for pos, possible_tokens in enumerate(possible_tokens_per_position): | |
mask[:, pos, possible_tokens] = 0 | |
logits = mask + logits | |
predictions = [] | |
for _ in range(num_sequences): | |
# Decode the predicted DNA sequence from the model output | |
if use_constrained_search: | |
# Use constrained beam search with GC bounds | |
predicted_indices = constrained_beam_search_simple( | |
logits=logits.squeeze(0), | |
protein_sequence=protein, | |
gc_bounds=gc_bounds, | |
max_attempts=50, | |
) | |
elif deterministic: | |
predicted_indices = logits.argmax(dim=-1).squeeze().tolist() | |
else: | |
predicted_indices = sample_non_deterministic( | |
logits=logits, temperature=temperature, top_p=top_p | |
) | |
predicted_dna = list(map(INDEX2TOKEN.__getitem__, predicted_indices)) | |
predicted_dna = ( | |
"".join([token[-3:] for token in predicted_dna]).strip().upper() | |
) | |
predictions.append( | |
DNASequencePrediction( | |
organism=organism_name, | |
protein=protein, | |
processed_input=merged_seq, | |
predicted_dna=predicted_dna, | |
) | |
) | |
return predictions[0] if num_sequences == 1 else predictions | |
class BeamCandidate: | |
"""Represents a candidate sequence in the beam search.""" | |
tokens: List[int] | |
score: float | |
gc_count: int | |
length: int | |
def __post_init__(self): | |
self.gc_ratio = self.gc_count / max(self.length, 1) | |
def __lt__(self, other): | |
return self.score < other.score | |
def _calculate_true_future_gc_range( | |
current_pos: int, | |
protein_sequence: str, | |
current_gc_count: int, | |
current_length: int | |
) -> Tuple[float, float]: | |
""" | |
Calculate the true minimum and maximum possible final GC content | |
given current state and remaining amino acids (perfect foresight). | |
Args: | |
current_pos: Current position in protein sequence | |
protein_sequence: Full protein sequence | |
current_gc_count: Current GC count in partial sequence | |
current_length: Current length in nucleotides | |
Returns: | |
Tuple of (min_possible_final_gc_ratio, max_possible_final_gc_ratio) | |
""" | |
if current_pos >= len(protein_sequence): | |
# Already at end, return current ratio | |
final_ratio = current_gc_count / max(current_length, 1) | |
return final_ratio, final_ratio | |
# Calculate remaining amino acids | |
remaining_aas = protein_sequence[current_pos:] | |
# Calculate min/max possible GC from remaining amino acids | |
min_future_gc = 0 | |
max_future_gc = 0 | |
for aa in remaining_aas: | |
if aa.upper() in AA_MIN_GC and aa.upper() in AA_MAX_GC: | |
min_future_gc += AA_MIN_GC[aa.upper()] | |
max_future_gc += AA_MAX_GC[aa.upper()] | |
else: | |
# If amino acid not found, assume moderate GC (1-2 range) | |
min_future_gc += 1 | |
max_future_gc += 2 | |
# Calculate final sequence length | |
final_length = current_length + len(remaining_aas) * 3 | |
# Calculate min/max possible final GC ratios | |
min_final_gc_ratio = (current_gc_count + min_future_gc) / final_length | |
max_final_gc_ratio = (current_gc_count + max_future_gc) / final_length | |
return min_final_gc_ratio, max_final_gc_ratio | |
def constrained_beam_search_simple( | |
logits: torch.Tensor, | |
protein_sequence: str, | |
gc_bounds: Tuple[float, float] = (0.30, 0.70), | |
max_attempts: int = 100, | |
) -> List[int]: | |
""" | |
Simple constrained search - try multiple greedy samples and pick best one within GC bounds. | |
""" | |
min_gc, max_gc = gc_bounds | |
seq_len = min(logits.shape[0], len(protein_sequence)) | |
# Convert to probabilities | |
probs = torch.softmax(logits, dim=-1) | |
valid_sequences = [] | |
for attempt in range(max_attempts): | |
tokens = [] | |
total_gc = 0 | |
# Generate sequence position by position | |
for pos in range(seq_len): | |
aa = protein_sequence[pos] | |
possible_tokens = AMINO_ACID_TO_INDEX.get(aa, []) | |
if not possible_tokens: | |
continue | |
# Filter tokens by current constraints and get probabilities | |
candidates = [] | |
for token_idx in possible_tokens: | |
if token_idx < len(probs[pos]) and token_idx < len(GC_COUNTS_PER_TOKEN): | |
prob = probs[pos][token_idx].item() | |
gc_contribution = int(GC_COUNTS_PER_TOKEN[token_idx].item()) | |
# Check if this token could still lead to a valid final sequence (perfect foresight) | |
new_gc_total = total_gc + gc_contribution | |
new_length = (pos + 1) * 3 | |
# Calculate what's possible for the final sequence given this choice | |
min_final_gc, max_final_gc = _calculate_true_future_gc_range( | |
pos + 1, protein_sequence, new_gc_total, new_length | |
) | |
# Only prune if there's NO OVERLAP between possible final range and target bounds | |
if max_final_gc >= min_gc and min_final_gc <= max_gc: | |
# Calculate gentle GC penalty to steer toward target center | |
target_gc = (min_gc + max_gc) / 2 # Target center (e.g., 0.50 for bounds 0.45-0.55) | |
current_projected_gc = (min_final_gc + max_final_gc) / 2 # Projected center | |
# Only apply penalty if we're significantly off-target AND late in sequence | |
sequence_progress = (pos + 1) / seq_len | |
if sequence_progress > 0.3: # Only apply penalty after 30% of sequence | |
gc_deviation = abs(current_projected_gc - target_gc) | |
if gc_deviation > 0.05: # Only if >5% deviation from target | |
# Gentle penalty: reduce probability by small factor | |
penalty_factor = max(0.7, 1.0 - 0.3 * gc_deviation) # 0.7-1.0 range | |
prob = prob * penalty_factor | |
candidates.append((token_idx, prob, gc_contribution)) | |
if not candidates: | |
# If no valid candidates, break and try next attempt | |
break | |
# Sample from valid candidates (with temperature) | |
if attempt == 0: | |
# First attempt: greedy (highest probability) | |
best_token = max(candidates, key=lambda x: x[1]) | |
else: | |
# Other attempts: sample with some randomness | |
probs_list = [c[1] for c in candidates] | |
if sum(probs_list) > 0: | |
# Normalize probabilities | |
probs_array = np.array(probs_list) | |
probs_array = probs_array / probs_array.sum() | |
# Sample | |
chosen_idx = np.random.choice(len(candidates), p=probs_array) | |
best_token = candidates[chosen_idx] | |
else: | |
best_token = candidates[0] | |
tokens.append(best_token[0]) | |
total_gc += best_token[2] | |
# Check if we got a complete sequence | |
if len(tokens) == seq_len: | |
final_gc_ratio = total_gc / (seq_len * 3) | |
if min_gc <= final_gc_ratio <= max_gc: | |
# Calculate sequence score (sum of log probabilities) | |
score = sum(np.log(probs[i][tokens[i]].item() + 1e-8) for i in range(len(tokens))) | |
valid_sequences.append((tokens, score, final_gc_ratio)) | |
if not valid_sequences: | |
raise ValueError(f"Could not generate valid sequence within GC bounds {gc_bounds} after {max_attempts} attempts") | |
# Return the sequence with highest score | |
best_sequence = max(valid_sequences, key=lambda x: x[1]) | |
return best_sequence[0] | |
def constrained_beam_search( | |
logits: torch.Tensor, | |
protein_sequence: str, | |
gc_bounds: Tuple[float, float] = (0.30, 0.70), | |
beam_size: int = 5, | |
length_penalty: float = 1.0, | |
diversity_penalty: float = 0.0, | |
temperature: float = 1.0, | |
max_candidates: int = 100, | |
position_aware_gc_penalty: bool = True, | |
gc_penalty_strength: float = 2.0, | |
) -> List[int]: | |
""" | |
Constrained beam search with exact per-residue GC bounds tracking. | |
Priority #1: Exact per-residue GC bounds tracking | |
- Tracks cumulative GC content after each codon selection | |
- Prunes candidates that would violate GC bounds | |
- Maintains beam of valid candidates | |
Priority #2: Position-aware GC penalty mechanism | |
- Applies variable penalty weights based on sequence position | |
- Preserves flexibility early, applies pressure when necessary | |
- Uses progressive penalty scaling based on deviation severity | |
Args: | |
logits (torch.Tensor): Model logits of shape [seq_len, vocab_size] | |
protein_sequence (str): Input protein sequence | |
gc_bounds (Tuple[float, float]): (min_gc, max_gc) bounds | |
beam_size (int): Number of candidates to maintain | |
length_penalty (float): Length penalty for scoring | |
diversity_penalty (float): Diversity penalty for scoring | |
temperature (float): Temperature for probability scaling | |
max_candidates (int): Maximum candidates to consider per position | |
position_aware_gc_penalty (bool): Whether to use position-aware GC penalties | |
gc_penalty_strength (float): Strength of GC penalty adjustment | |
Returns: | |
List[int]: Best sequence token indices | |
""" | |
min_gc, max_gc = gc_bounds | |
seq_len = logits.shape[0] | |
protein_len = len(protein_sequence) | |
# Ensure we don't go beyond the protein sequence | |
if seq_len > protein_len: | |
print(f"Warning: logits length ({seq_len}) > protein length ({protein_len}). Truncating to protein length.") | |
seq_len = protein_len | |
logits = logits[:protein_len] | |
# Initialize beam with empty candidate | |
beam = [BeamCandidate(tokens=[], score=0.0, gc_count=0, length=0)] | |
# Apply temperature scaling | |
if temperature != 1.0: | |
logits = logits / temperature | |
# Convert to probabilities | |
probs = torch.softmax(logits, dim=-1) | |
for pos in range(min(seq_len, len(protein_sequence))): | |
# Get possible tokens for current amino acid | |
aa = protein_sequence[pos] | |
possible_tokens = AMINO_ACID_TO_INDEX.get(aa, []) | |
if not possible_tokens: | |
# Fallback to all tokens if amino acid not found | |
possible_tokens = list(range(probs.shape[1])) | |
# Get top candidates for this position | |
pos_probs = probs[pos] | |
top_candidates = [] | |
for token_idx in possible_tokens: | |
if token_idx < len(pos_probs) and token_idx < len(GC_COUNTS_PER_TOKEN): | |
prob = pos_probs[token_idx].item() | |
gc_contribution = int(GC_COUNTS_PER_TOKEN[token_idx].item()) | |
# Only include tokens with valid probabilities | |
if prob > 1e-10: # Avoid extremely low probabilities | |
top_candidates.append((token_idx, prob, gc_contribution)) | |
# Sort by probability and take top max_candidates | |
top_candidates.sort(key=lambda x: x[1], reverse=True) | |
top_candidates = top_candidates[:max_candidates] | |
# If no valid candidates found, fallback to all possible tokens for this amino acid | |
if not top_candidates: | |
for token_idx in possible_tokens[:min(len(possible_tokens), max_candidates)]: | |
if token_idx < len(pos_probs) and token_idx < len(GC_COUNTS_PER_TOKEN): | |
prob = max(pos_probs[token_idx].item(), 1e-10) # Ensure minimum probability | |
gc_contribution = int(GC_COUNTS_PER_TOKEN[token_idx].item()) | |
top_candidates.append((token_idx, prob, gc_contribution)) | |
# Generate new beam candidates | |
new_beam = [] | |
for candidate in beam: | |
for token_idx, prob, gc_contribution in top_candidates: | |
# Calculate new GC stats | |
new_gc_count = candidate.gc_count + gc_contribution | |
new_length = candidate.length + 3 # Each codon is 3 nucleotides | |
new_gc_ratio = new_gc_count / new_length | |
# Priority #2: Position-aware GC penalty mechanism | |
gc_penalty = 0.0 | |
if position_aware_gc_penalty: | |
# Calculate position weight (more penalty towards end of sequence) | |
position_weight = (pos + 1) / seq_len | |
# Calculate GC deviation severity | |
target_gc = (min_gc + max_gc) / 2 | |
gc_deviation = abs(new_gc_ratio - target_gc) | |
deviation_severity = gc_deviation / ((max_gc - min_gc) / 2) | |
# Apply progressive penalty | |
if deviation_severity > 0.5: # Soft penalty zone | |
gc_penalty = gc_penalty_strength * position_weight * (deviation_severity - 0.5) ** 2 | |
# Hard constraint: still prune sequences that exceed bounds | |
if new_gc_ratio < min_gc or new_gc_ratio > max_gc: | |
continue # Prune invalid candidates | |
else: | |
# Priority #1: Hard GC bounds only | |
if new_gc_ratio < min_gc or new_gc_ratio > max_gc: | |
continue # Prune invalid candidates | |
# Calculate score with GC penalty | |
new_score = candidate.score + np.log(prob + 1e-8) - gc_penalty | |
# Apply length penalty | |
if length_penalty != 1.0: | |
length_norm = ((pos + 1) ** length_penalty) | |
normalized_score = new_score / length_norm | |
else: | |
normalized_score = new_score | |
# Create new candidate | |
new_candidate = BeamCandidate( | |
tokens=candidate.tokens + [token_idx], | |
score=normalized_score, | |
gc_count=new_gc_count, | |
length=new_length | |
) | |
new_beam.append(new_candidate) | |
# Apply diversity penalty if specified | |
if diversity_penalty > 0.0: | |
new_beam = _apply_diversity_penalty(new_beam, diversity_penalty) | |
# Keep top beam_size candidates | |
beam = sorted(new_beam, key=lambda x: x.score, reverse=True)[:beam_size] | |
# Priority #3: Adaptive beam rescue for difficult sequences | |
if not beam: | |
# Attempt beam rescue by relaxing constraints progressively | |
rescue_attempts = 0 | |
max_rescue_attempts = 3 | |
while not beam and rescue_attempts < max_rescue_attempts: | |
rescue_attempts += 1 | |
# Progressive relaxation strategy | |
if rescue_attempts == 1: | |
# First attempt: increase beam size and relax GC bounds slightly | |
temp_beam_size = min(beam_size * 2, max_candidates) | |
temp_gc_bounds = (min_gc * 0.95, max_gc * 1.05) | |
elif rescue_attempts == 2: | |
# Second attempt: further relax GC bounds and increase candidates | |
temp_beam_size = min(beam_size * 3, max_candidates) | |
temp_gc_bounds = (min_gc * 0.9, max_gc * 1.1) | |
else: | |
# Final attempt: maximum relaxation | |
temp_beam_size = max_candidates | |
temp_gc_bounds = (min_gc * 0.85, max_gc * 1.15) | |
# Retry beam generation with relaxed parameters | |
rescue_beam = [] | |
# Use previous beam state or start fresh if this is the first position with no beam | |
previous_beam = beam if beam else [BeamCandidate(tokens=[], score=0.0, gc_count=0, length=0)] | |
for candidate in previous_beam: | |
for token_idx, prob, gc_contribution in top_candidates: | |
new_gc_count = candidate.gc_count + gc_contribution | |
new_length = candidate.length + 3 | |
new_gc_ratio = new_gc_count / new_length | |
# Check relaxed bounds | |
if temp_gc_bounds[0] <= new_gc_ratio <= temp_gc_bounds[1]: | |
# Apply reduced GC penalty for rescue | |
gc_penalty = 0.0 | |
if position_aware_gc_penalty: | |
position_weight = (pos + 1) / seq_len | |
target_gc = (min_gc + max_gc) / 2 | |
gc_deviation = abs(new_gc_ratio - target_gc) | |
deviation_severity = gc_deviation / ((max_gc - min_gc) / 2) | |
# Reduced penalty for rescue | |
if deviation_severity > 0.7: | |
gc_penalty = (gc_penalty_strength * 0.5) * position_weight * (deviation_severity - 0.7) ** 2 | |
new_score = candidate.score + np.log(prob + 1e-8) - gc_penalty | |
if length_penalty != 1.0: | |
length_norm = ((pos + 1) ** length_penalty) | |
normalized_score = new_score / length_norm | |
else: | |
normalized_score = new_score | |
rescue_candidate = BeamCandidate( | |
tokens=candidate.tokens + [token_idx], | |
score=normalized_score, | |
gc_count=new_gc_count, | |
length=new_length | |
) | |
rescue_beam.append(rescue_candidate) | |
# Keep top candidates from rescue attempt | |
if rescue_beam: | |
beam = sorted(rescue_beam, key=lambda x: x.score, reverse=True)[:temp_beam_size] | |
break | |
# If all rescue attempts failed, raise error | |
if not beam: | |
raise ValueError( | |
f"Beam rescue failed at position {pos} after {max_rescue_attempts} attempts. " | |
f"The GC constraints {gc_bounds} may be too restrictive for this protein sequence. " | |
f"Consider relaxing constraints or using a different approach." | |
) | |
# Return best candidate | |
best_candidate = max(beam, key=lambda x: x.score) | |
return best_candidate.tokens | |
# Wrapper function that tries simple approach first | |
def constrained_beam_search_wrapper( | |
logits: torch.Tensor, | |
protein_sequence: str, | |
gc_bounds: Tuple[float, float] = (0.30, 0.70), | |
**kwargs | |
) -> List[int]: | |
"""Wrapper that tries simple approach first, falls back to complex beam search.""" | |
try: | |
# Try simple approach first | |
return constrained_beam_search_simple(logits, protein_sequence, gc_bounds) | |
except ValueError: | |
# Fall back to complex beam search | |
return constrained_beam_search(logits, protein_sequence, gc_bounds, **kwargs) | |
def _apply_diversity_penalty(candidates: List[BeamCandidate], penalty: float) -> List[BeamCandidate]: | |
""" | |
Apply diversity penalty to reduce repetitive sequences. | |
Args: | |
candidates (List[BeamCandidate]): List of candidates | |
penalty (float): Diversity penalty strength | |
Returns: | |
List[BeamCandidate]: Candidates with diversity penalty applied | |
""" | |
if not candidates: | |
return candidates | |
# Count token occurrences | |
token_counts = {} | |
for candidate in candidates: | |
for token in candidate.tokens: | |
token_counts[token] = token_counts.get(token, 0) + 1 | |
# Apply penalty | |
for candidate in candidates: | |
diversity_score = 0.0 | |
for token in candidate.tokens: | |
if token_counts[token] > 1: | |
diversity_score += penalty * np.log(token_counts[token]) | |
candidate.score -= diversity_score | |
return candidates | |
def sample_non_deterministic( | |
logits: torch.Tensor, | |
temperature: float = 0.2, | |
top_p: float = 0.95, | |
) -> List[int]: | |
""" | |
Sample token indices from logits using temperature scaling and nucleus (top-p) sampling. | |
This function applies temperature scaling to the logits, computes probabilities, | |
and then performs nucleus sampling to select token indices. It is used for | |
non-deterministic decoding in language models to introduce randomness while | |
maintaining coherence in the generated sequences. | |
Args: | |
logits (torch.Tensor): The logits output from the model of shape | |
[seq_len, vocab_size] or [batch_size, seq_len, vocab_size]. | |
temperature (float, optional): Temperature value for scaling logits. | |
Must be a positive float. Defaults to 1.0. | |
top_p (float, optional): Cumulative probability threshold for nucleus sampling. | |
Must be a float between 0 and 1. Tokens with cumulative probability up to | |
`top_p` are considered for sampling. Defaults to 0.95. | |
Returns: | |
List[int]: A list of sampled token indices corresponding to the predicted tokens. | |
Raises: | |
ValueError: If `temperature` is not a positive float or if `top_p` is not between 0 and 1. | |
Example: | |
>>> logits = model_output.logits # Assume logits is a tensor of shape [seq_len, vocab_size] | |
>>> predicted_indices = sample_non_deterministic(logits, temperature=0.7, top_p=0.9) | |
""" | |
if not isinstance(temperature, (float, int)) or temperature <= 0: | |
raise ValueError("Temperature must be a positive float.") | |
if not isinstance(top_p, (float, int)) or not 0 < top_p <= 1.0: | |
raise ValueError("top_p must be a float between 0 and 1.") | |
# Compute probabilities using temperature scaling | |
probs = torch.softmax(logits / temperature, dim=-1) | |
# Remove batch dimension if present | |
if probs.dim() == 3: | |
probs = probs.squeeze(0) # Shape: [seq_len, vocab_size] | |
# Sort probabilities in descending order | |
probs_sort, probs_idx = torch.sort(probs, dim=-1, descending=True) | |
probs_sum = torch.cumsum(probs_sort, dim=-1) | |
mask = probs_sum - probs_sort > top_p | |
# Zero out probabilities for tokens beyond the top-p threshold | |
probs_sort[mask] = 0.0 | |
# Renormalize the probabilities | |
probs_sort.div_(probs_sort.sum(dim=-1, keepdim=True)) | |
next_token = torch.multinomial(probs_sort, num_samples=1) | |
predicted_indices = torch.gather(probs_idx, -1, next_token).squeeze(-1) | |
return predicted_indices.tolist() | |
def load_model( | |
model_path: Optional[str] = None, | |
device: torch.device = None, | |
attention_type: str = "original_full", | |
num_organisms: int = None, | |
remove_prefix: bool = True, | |
) -> torch.nn.Module: | |
""" | |
Load a BigBirdForMaskedLM model from a model file, checkpoint, or HuggingFace. | |
Args: | |
model_path (Optional[str]): Path to the model file or checkpoint. If None, | |
load from HuggingFace. | |
device (torch.device, optional): The device to load the model onto. | |
attention_type (str, optional): The type of attention, 'block_sparse' | |
or 'original_full'. | |
num_organisms (int, optional): Number of organisms, needed if loading from a | |
checkpoint that requires this. | |
remove_prefix (bool, optional): Whether to remove the "model." prefix from the | |
keys in the state dict. | |
Returns: | |
torch.nn.Module: The loaded model. | |
""" | |
if not model_path: | |
warnings.warn("Model path not provided. Loading from HuggingFace.", UserWarning) | |
model = BigBirdForMaskedLM.from_pretrained("adibvafa/CodonTransformer") | |
elif model_path.endswith(".ckpt"): | |
checkpoint = torch.load(model_path, map_location="cpu") | |
# Detect Lightning checkpoint vs raw state dict | |
if isinstance(checkpoint, dict) and "state_dict" in checkpoint: | |
state_dict = checkpoint["state_dict"] | |
if remove_prefix: | |
state_dict = { | |
k.replace("model.", ""): v for k, v in state_dict.items() | |
} | |
else: | |
# assume checkpoint itself is state_dict | |
state_dict = checkpoint | |
if num_organisms is None: | |
num_organisms = NUM_ORGANISMS | |
# Load model configuration and instantiate the model | |
config = load_bigbird_config(num_organisms) | |
model = BigBirdForMaskedLM(config=config) | |
model.load_state_dict(state_dict, strict=False) | |
elif model_path.endswith(".pt"): | |
state_dict = torch.load(model_path) | |
config = state_dict.pop("self.config") | |
model = BigBirdForMaskedLM(config=config) | |
model.load_state_dict(state_dict, strict=False) | |
else: | |
raise ValueError( | |
"Unsupported file type. Please provide a .ckpt or .pt file, " | |
"or None to load from HuggingFace." | |
) | |
# Prepare model for evaluation | |
model.bert.set_attention_type(attention_type) | |
model.eval() | |
if device: | |
model.to(device) | |
return model | |
def load_bigbird_config(num_organisms: int) -> BigBirdConfig: | |
""" | |
Load the config object used to train the BigBird transformer. | |
Args: | |
num_organisms (int): The number of organisms. | |
Returns: | |
BigBirdConfig: The configuration object for BigBird. | |
""" | |
config = transformers.BigBirdConfig( | |
vocab_size=len(TOKEN2INDEX), # Equal to len(tokenizer) | |
type_vocab_size=num_organisms, | |
sep_token_id=2, | |
) | |
return config | |
def create_model_from_checkpoint( | |
checkpoint_dir: str, output_model_dir: str, num_organisms: int | |
) -> None: | |
""" | |
Save a model to disk using a previous checkpoint. | |
Args: | |
checkpoint_dir (str): Directory where the checkpoint is stored. | |
output_model_dir (str): Directory where the model will be saved. | |
num_organisms (int): Number of organisms. | |
""" | |
checkpoint = load_model(model_path=checkpoint_dir, num_organisms=num_organisms) | |
state_dict = checkpoint.state_dict() | |
state_dict["self.config"] = load_bigbird_config(num_organisms=num_organisms) | |
# Save the model state dict to the output directory | |
torch.save(state_dict, output_model_dir) | |
def load_tokenizer(tokenizer_path: Optional[Union[str, PreTrainedTokenizerFast]] = None) -> PreTrainedTokenizerFast: | |
""" | |
Create and return a tokenizer object from tokenizer path or HuggingFace. | |
Args: | |
tokenizer_path (Optional[Union[str, PreTrainedTokenizerFast]]): Path to the tokenizer file, | |
a pre-loaded tokenizer object, or None. If None, load from HuggingFace. | |
Returns: | |
PreTrainedTokenizerFast: The tokenizer object. | |
""" | |
# If a tokenizer object is already provided, return it | |
if isinstance(tokenizer_path, PreTrainedTokenizerFast): | |
return tokenizer_path | |
# If no path is provided, load from HuggingFace | |
if not tokenizer_path: | |
warnings.warn( | |
"Tokenizer path not provided. Loading from HuggingFace.", UserWarning | |
) | |
return AutoTokenizer.from_pretrained("adibvafa/CodonTransformer") | |
# Load from file path | |
return transformers.PreTrainedTokenizerFast( | |
tokenizer_file=tokenizer_path, | |
bos_token="[CLS]", | |
eos_token="[SEP]", | |
unk_token="[UNK]", | |
sep_token="[SEP]", | |
pad_token="[PAD]", | |
cls_token="[CLS]", | |
mask_token="[MASK]", | |
) | |
def tokenize( | |
batch: List[Dict[str, Any]], | |
tokenizer: Union[PreTrainedTokenizerFast, str] = None, | |
max_len: int = 2048, | |
) -> BatchEncoding: | |
""" | |
Return the tokenized sequences given a batch of input data. | |
Each data in the batch is expected to be a dictionary with "codons" and | |
"organism" keys. | |
Args: | |
batch (List[Dict[str, Any]]): A list of dictionaries with "codons" and | |
"organism" keys. | |
tokenizer (PreTrainedTokenizerFast, str, optional): The tokenizer object or | |
path to the tokenizer file. | |
max_len (int, optional): Maximum length of the tokenized sequence. | |
Returns: | |
BatchEncoding: The tokenized batch. | |
""" | |
if not isinstance(tokenizer, PreTrainedTokenizerFast): | |
tokenizer = load_tokenizer(tokenizer) | |
tokenized = tokenizer( | |
[data["codons"] for data in batch], | |
return_attention_mask=True, | |
return_token_type_ids=True, | |
truncation=True, | |
padding=True, | |
max_length=max_len, | |
return_tensors="pt", | |
) | |
# Add token type IDs for species | |
seq_len = tokenized["input_ids"].shape[-1] | |
species_index = torch.tensor([[data["organism"]] for data in batch]) | |
tokenized["token_type_ids"] = species_index.repeat(1, seq_len) | |
return tokenized | |
def validate_and_convert_organism(organism: Union[int, str]) -> Tuple[int, str]: | |
""" | |
Validate and convert the organism input to both ID and name. | |
This function takes either an organism ID or name as input and returns both | |
the ID and name. It performs validation to ensure the input corresponds to | |
a valid organism in the ORGANISM2ID dictionary. | |
Args: | |
organism (Union[int, str]): Either the ID of the organism (int) or its | |
name (str). | |
Returns: | |
Tuple[int, str]: A tuple containing the organism ID (int) and name (str). | |
Raises: | |
ValueError: If the input is neither a string nor an integer, if the | |
organism name is not found in ORGANISM2ID, if the organism ID is not a | |
value in ORGANISM2ID, or if no name is found for a given ID. | |
Note: | |
This function relies on the ORGANISM2ID dictionary imported from | |
CodonTransformer.CodonUtils, which maps organism names to their | |
corresponding IDs. | |
""" | |
if isinstance(organism, str): | |
if organism not in ORGANISM2ID: | |
raise ValueError( | |
f"Invalid organism name: {organism}. " | |
"Please use a valid organism name or ID." | |
) | |
organism_id = ORGANISM2ID[organism] | |
organism_name = organism | |
elif isinstance(organism, int): | |
if organism not in ORGANISM2ID.values(): | |
raise ValueError( | |
f"Invalid organism ID: {organism}. " | |
"Please use a valid organism name or ID." | |
) | |
organism_id = organism | |
organism_name = next( | |
(name for name, id in ORGANISM2ID.items() if id == organism), None | |
) | |
if organism_name is None: | |
raise ValueError(f"No organism name found for ID: {organism}") | |
return organism_id, organism_name | |
def get_high_frequency_choice_sequence( | |
protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] | |
) -> str: | |
""" | |
Return the DNA sequence optimized using High Frequency Choice (HFC) approach | |
in which the most frequent codon for a given amino acid is always chosen. | |
Args: | |
protein (str): The protein sequence. | |
codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon | |
frequencies for each amino acid. | |
Returns: | |
str: The optimized DNA sequence. | |
""" | |
# Select the most frequent codon for each amino acid in the protein sequence | |
dna_codons = [ | |
codon_frequencies[aminoacid][0][np.argmax(codon_frequencies[aminoacid][1])] | |
for aminoacid in protein | |
] | |
return "".join(dna_codons) | |
def precompute_most_frequent_codons( | |
codon_frequencies: Dict[str, Tuple[List[str], List[float]]], | |
) -> Dict[str, str]: | |
""" | |
Precompute the most frequent codon for each amino acid. | |
Args: | |
codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon | |
frequencies for each amino acid. | |
Returns: | |
Dict[str, str]: The most frequent codon for each amino acid. | |
""" | |
# Create a dictionary mapping each amino acid to its most frequent codon | |
return { | |
aminoacid: codons[np.argmax(frequencies)] | |
for aminoacid, (codons, frequencies) in codon_frequencies.items() | |
} | |
def get_high_frequency_choice_sequence_optimized( | |
protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] | |
) -> str: | |
""" | |
Efficient implementation of get_high_frequency_choice_sequence that uses | |
vectorized operations and helper functions, achieving up to x10 faster speed. | |
Args: | |
protein (str): The protein sequence. | |
codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon | |
frequencies for each amino acid. | |
Returns: | |
str: The optimized DNA sequence. | |
""" | |
# Precompute the most frequent codons for each amino acid | |
most_frequent_codons = precompute_most_frequent_codons(codon_frequencies) | |
return "".join(most_frequent_codons[aminoacid] for aminoacid in protein) | |
def get_background_frequency_choice_sequence( | |
protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] | |
) -> str: | |
""" | |
Return the DNA sequence optimized using Background Frequency Choice (BFC) | |
approach in which a random codon for a given amino acid is chosen using | |
the codon frequencies probability distribution. | |
Args: | |
protein (str): The protein sequence. | |
codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon | |
frequencies for each amino acid. | |
Returns: | |
str: The optimized DNA sequence. | |
""" | |
# Select a random codon for each amino acid based on the codon frequencies | |
# probability distribution | |
dna_codons = [ | |
np.random.choice( | |
codon_frequencies[aminoacid][0], p=codon_frequencies[aminoacid][1] | |
) | |
for aminoacid in protein | |
] | |
return "".join(dna_codons) | |
def precompute_cdf( | |
codon_frequencies: Dict[str, Tuple[List[str], List[float]]], | |
) -> Dict[str, Tuple[List[str], Any]]: | |
""" | |
Precompute the cumulative distribution function (CDF) for each amino acid. | |
Args: | |
codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon | |
frequencies for each amino acid. | |
Returns: | |
Dict[str, Tuple[List[str], Any]]: CDFs for each amino acid. | |
""" | |
cdf = {} | |
# Calculate the cumulative distribution function for each amino acid | |
for aminoacid, (codons, frequencies) in codon_frequencies.items(): | |
cdf[aminoacid] = (codons, np.cumsum(frequencies)) | |
return cdf | |
def get_background_frequency_choice_sequence_optimized( | |
protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] | |
) -> str: | |
""" | |
Efficient implementation of get_background_frequency_choice_sequence that uses | |
vectorized operations and helper functions, achieving up to x8 faster speed. | |
Args: | |
protein (str): The protein sequence. | |
codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon | |
frequencies for each amino acid. | |
Returns: | |
str: The optimized DNA sequence. | |
""" | |
dna_codons = [] | |
cdf = precompute_cdf(codon_frequencies) | |
# Select a random codon for each amino acid using the precomputed CDFs | |
for aminoacid in protein: | |
codons, cumulative_prob = cdf[aminoacid] | |
selected_codon_index = np.searchsorted(cumulative_prob, np.random.rand()) | |
dna_codons.append(codons[selected_codon_index]) | |
return "".join(dna_codons) | |
def get_uniform_random_choice_sequence( | |
protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]] | |
) -> str: | |
""" | |
Return the DNA sequence optimized using Uniform Random Choice (URC) approach | |
in which a random codon for a given amino acid is chosen using a uniform | |
prior. | |
Args: | |
protein (str): The protein sequence. | |
codon_frequencies (Dict[str, Tuple[List[str], List[float]]]): Codon | |
frequencies for each amino acid. | |
Returns: | |
str: The optimized DNA sequence. | |
""" | |
# Select a random codon for each amino acid using a uniform prior distribution | |
dna_codons = [] | |
for aminoacid in protein: | |
codons = codon_frequencies[aminoacid][0] | |
random_index = np.random.randint(0, len(codons)) | |
dna_codons.append(codons[random_index]) | |
return "".join(dna_codons) | |
def get_icor_prediction(input_seq: str, model_path: str, stop_symbol: str) -> str: | |
""" | |
Return the optimized codon sequence for the given protein sequence using ICOR. | |
Credit: ICOR: improving codon optimization with recurrent neural networks | |
Rishab Jain, Aditya Jain, Elizabeth Mauro, Kevin LeShane, Douglas | |
Densmore | |
Args: | |
input_seq (str): The input protein sequence. | |
model_path (str): The path to the ICOR model. | |
stop_symbol (str): The symbol representing stop codons in the sequence. | |
Returns: | |
str: The optimized DNA sequence. | |
""" | |
input_seq = input_seq.strip().upper() | |
input_seq = input_seq.replace(stop_symbol, "*") | |
# Define categorical labels from when model was trained. | |
labels = [ | |
"AAA", | |
"AAC", | |
"AAG", | |
"AAT", | |
"ACA", | |
"ACG", | |
"ACT", | |
"AGC", | |
"ATA", | |
"ATC", | |
"ATG", | |
"ATT", | |
"CAA", | |
"CAC", | |
"CAG", | |
"CCG", | |
"CCT", | |
"CTA", | |
"CTC", | |
"CTG", | |
"CTT", | |
"GAA", | |
"GAT", | |
"GCA", | |
"GCC", | |
"GCG", | |
"GCT", | |
"GGA", | |
"GGC", | |
"GTC", | |
"GTG", | |
"GTT", | |
"TAA", | |
"TAT", | |
"TCA", | |
"TCG", | |
"TCT", | |
"TGG", | |
"TGT", | |
"TTA", | |
"TTC", | |
"TTG", | |
"TTT", | |
"ACC", | |
"CAT", | |
"CCA", | |
"CGG", | |
"CGT", | |
"GAC", | |
"GAG", | |
"GGT", | |
"AGT", | |
"GGG", | |
"GTA", | |
"TGC", | |
"CCC", | |
"CGA", | |
"CGC", | |
"TAC", | |
"TAG", | |
"TCC", | |
"AGA", | |
"AGG", | |
"TGA", | |
] | |
# Define aa to integer table | |
def aa2int(seq: str) -> List[int]: | |
_aa2int = { | |
"A": 1, | |
"R": 2, | |
"N": 3, | |
"D": 4, | |
"C": 5, | |
"Q": 6, | |
"E": 7, | |
"G": 8, | |
"H": 9, | |
"I": 10, | |
"L": 11, | |
"K": 12, | |
"M": 13, | |
"F": 14, | |
"P": 15, | |
"S": 16, | |
"T": 17, | |
"W": 18, | |
"Y": 19, | |
"V": 20, | |
"B": 21, | |
"Z": 22, | |
"X": 23, | |
"*": 24, | |
"-": 25, | |
"?": 26, | |
} | |
return [_aa2int[i] for i in seq] | |
# Create empty array to fill | |
oh_array = np.zeros(shape=(26, len(input_seq))) | |
# Load placements from aa2int | |
aa_placement = aa2int(input_seq) | |
# One-hot encode the amino acid sequence: | |
# style nit: more pythonic to write for i in range(0, len(aa_placement)): | |
for i in range(0, len(aa_placement)): | |
oh_array[aa_placement[i], i] = 1 | |
i += 1 | |
oh_array = [oh_array] | |
x = np.array(np.transpose(oh_array)) | |
y = x.astype(np.float32) | |
y = np.reshape(y, (y.shape[0], 1, 26)) | |
# Start ICOR session using model. | |
sess = rt.InferenceSession(model_path) | |
input_name = sess.get_inputs()[0].name | |
# Get prediction: | |
pred_onx = sess.run(None, {input_name: y}) | |
# Get the index of the highest probability from softmax output: | |
pred_indices = [] | |
for pred in pred_onx[0]: | |
pred_indices.append(np.argmax(pred)) | |
out_str = "" | |
for index in pred_indices: | |
out_str += labels[index] | |
return out_str | |